Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5ETD8

Protein Details
Accession V5ETD8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
126-147NVSWSKDERRRRTPPHHRTEHDBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 10.5, cyto_mito 7, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003607  HD/PDEase_dom  
CDD cd00077  HDc  
Amino Acid Sequences MDDLSPVLASTSLYAPASRLPPSQKADIIAAAESFVESAFAHHDPSHDYHHVHRVRLLALSLTRSPEAGAVDKLVVELGALFHDLTDAKYSSSTTPSSVLAPFWADPVCSGVTRGQRESVEHIVSNVSWSKDERRRRTPPHHRTEHDTQLQSWLDSCREFHCVSDADRLDAIGSIGVLRPLYVPPNNPTDNPVPPAEQAEGYNGSAVGHFYEKLLKIRGDRLYTIAGRNEAERRQGAMRAFLDELDLEWLVGKQGSEMALLEDEEEEEGEEFHEEQGTNGVQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.16
4 0.19
5 0.2
6 0.24
7 0.27
8 0.34
9 0.39
10 0.43
11 0.41
12 0.4
13 0.39
14 0.36
15 0.32
16 0.25
17 0.2
18 0.15
19 0.13
20 0.1
21 0.08
22 0.06
23 0.06
24 0.05
25 0.06
26 0.09
27 0.09
28 0.11
29 0.12
30 0.13
31 0.16
32 0.19
33 0.25
34 0.25
35 0.27
36 0.29
37 0.38
38 0.41
39 0.39
40 0.38
41 0.34
42 0.32
43 0.31
44 0.28
45 0.21
46 0.19
47 0.21
48 0.2
49 0.2
50 0.19
51 0.18
52 0.17
53 0.16
54 0.17
55 0.15
56 0.13
57 0.12
58 0.12
59 0.11
60 0.11
61 0.09
62 0.07
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.06
73 0.08
74 0.08
75 0.08
76 0.09
77 0.11
78 0.11
79 0.14
80 0.14
81 0.13
82 0.14
83 0.14
84 0.15
85 0.15
86 0.13
87 0.11
88 0.12
89 0.11
90 0.1
91 0.1
92 0.08
93 0.07
94 0.09
95 0.1
96 0.08
97 0.09
98 0.13
99 0.18
100 0.21
101 0.21
102 0.22
103 0.22
104 0.23
105 0.27
106 0.26
107 0.22
108 0.19
109 0.18
110 0.16
111 0.15
112 0.16
113 0.13
114 0.1
115 0.09
116 0.1
117 0.18
118 0.25
119 0.35
120 0.41
121 0.48
122 0.56
123 0.64
124 0.74
125 0.78
126 0.81
127 0.81
128 0.82
129 0.75
130 0.73
131 0.71
132 0.68
133 0.63
134 0.53
135 0.43
136 0.4
137 0.38
138 0.3
139 0.25
140 0.18
141 0.13
142 0.13
143 0.14
144 0.1
145 0.14
146 0.14
147 0.13
148 0.15
149 0.15
150 0.16
151 0.22
152 0.21
153 0.18
154 0.18
155 0.18
156 0.15
157 0.14
158 0.12
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.06
168 0.1
169 0.11
170 0.14
171 0.16
172 0.23
173 0.24
174 0.24
175 0.27
176 0.28
177 0.28
178 0.29
179 0.28
180 0.22
181 0.21
182 0.23
183 0.2
184 0.17
185 0.15
186 0.15
187 0.15
188 0.14
189 0.14
190 0.11
191 0.1
192 0.09
193 0.09
194 0.08
195 0.07
196 0.07
197 0.07
198 0.12
199 0.14
200 0.17
201 0.2
202 0.22
203 0.23
204 0.3
205 0.35
206 0.34
207 0.33
208 0.32
209 0.34
210 0.34
211 0.35
212 0.3
213 0.27
214 0.24
215 0.26
216 0.28
217 0.25
218 0.28
219 0.26
220 0.27
221 0.27
222 0.31
223 0.29
224 0.31
225 0.29
226 0.28
227 0.27
228 0.24
229 0.22
230 0.18
231 0.17
232 0.13
233 0.12
234 0.09
235 0.09
236 0.09
237 0.09
238 0.09
239 0.09
240 0.06
241 0.08
242 0.09
243 0.09
244 0.09
245 0.1
246 0.1
247 0.1
248 0.1
249 0.09
250 0.09
251 0.08
252 0.08
253 0.07
254 0.07
255 0.07
256 0.07
257 0.08
258 0.08
259 0.08
260 0.11
261 0.1
262 0.1
263 0.15