Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5E6I1

Protein Details
Accession V5E6I1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
6-33TKTKSSTSTQKRATKSKKDPAAPKRPLSHydrophilic
NLS Segment(s)
PositionSequence
20-26KSKKDPA
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAKADTKTKSSTSTQKRATKSKKDPAAPKRPLSAYMFFSQDHRERVKQANPEAGFGDVGRLLGAKWKEMSEAEKKPYNDMATRDKARAEAEKAAYNKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.7
4 0.76
5 0.8
6 0.8
7 0.81
8 0.81
9 0.8
10 0.8
11 0.84
12 0.83
13 0.84
14 0.8
15 0.74
16 0.69
17 0.62
18 0.57
19 0.52
20 0.45
21 0.38
22 0.33
23 0.31
24 0.26
25 0.26
26 0.27
27 0.26
28 0.26
29 0.26
30 0.25
31 0.27
32 0.32
33 0.36
34 0.36
35 0.35
36 0.38
37 0.35
38 0.35
39 0.31
40 0.26
41 0.21
42 0.16
43 0.14
44 0.07
45 0.06
46 0.05
47 0.05
48 0.04
49 0.09
50 0.09
51 0.1
52 0.11
53 0.11
54 0.13
55 0.14
56 0.19
57 0.22
58 0.28
59 0.31
60 0.36
61 0.37
62 0.39
63 0.42
64 0.41
65 0.37
66 0.37
67 0.4
68 0.43
69 0.46
70 0.44
71 0.4
72 0.39
73 0.39
74 0.39
75 0.36
76 0.34
77 0.35
78 0.4
79 0.43