Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5EWY7

Protein Details
Accession V5EWY7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-29TSIPIVKKRTKAFKRHHSDRYHRVGEBasic
NLS Segment(s)
PositionSequence
10-50KKRTKAFKRHHSDRYHRVGESWRKPKGIDSAVRRRFRSVVR
Subcellular Location(s) mito 16, cyto 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAATSIPIVKKRTKAFKRHHSDRYHRVGESWRKPKGIDSAVRRRFRSVVRMPKIGYGSNKKTRHLMPNGFRRLVVSNTRDVELLLMHNGVYAAEIAHNVSSKKRIDILEKAKALGVKVTNANARVRAQEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.8
4 0.85
5 0.87
6 0.87
7 0.87
8 0.87
9 0.86
10 0.85
11 0.78
12 0.68
13 0.61
14 0.61
15 0.61
16 0.62
17 0.61
18 0.55
19 0.52
20 0.52
21 0.53
22 0.52
23 0.49
24 0.46
25 0.47
26 0.53
27 0.61
28 0.67
29 0.64
30 0.58
31 0.55
32 0.5
33 0.51
34 0.49
35 0.51
36 0.5
37 0.53
38 0.5
39 0.5
40 0.49
41 0.42
42 0.39
43 0.36
44 0.38
45 0.45
46 0.46
47 0.43
48 0.46
49 0.47
50 0.49
51 0.48
52 0.48
53 0.46
54 0.54
55 0.57
56 0.53
57 0.49
58 0.43
59 0.38
60 0.34
61 0.32
62 0.24
63 0.24
64 0.25
65 0.26
66 0.24
67 0.22
68 0.19
69 0.13
70 0.12
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.06
84 0.07
85 0.08
86 0.1
87 0.15
88 0.17
89 0.18
90 0.23
91 0.25
92 0.3
93 0.39
94 0.45
95 0.48
96 0.48
97 0.47
98 0.44
99 0.42
100 0.37
101 0.32
102 0.26
103 0.21
104 0.23
105 0.27
106 0.29
107 0.31
108 0.33
109 0.32
110 0.33