Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5F0B7

Protein Details
Accession V5F0B7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDEVKPIRKREPKTEPKLDPBasic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025246  IS30-like_HTH  
IPR016032  Sig_transdc_resp-reg_C-effctor  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF13936  HTH_38  
Amino Acid Sequences MDEVKPIRKREPKTEPKLDPEQEASGSVSPPSSPTKGPIRKTTDAERQVIMTMAVAGKRPKEIAAALDLKPTTVSKFLERSRKKALNSMGTDVAKLIAQSPPKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.77
4 0.8
5 0.72
6 0.64
7 0.57
8 0.49
9 0.39
10 0.35
11 0.29
12 0.21
13 0.19
14 0.15
15 0.12
16 0.09
17 0.11
18 0.14
19 0.14
20 0.14
21 0.18
22 0.28
23 0.35
24 0.39
25 0.45
26 0.5
27 0.52
28 0.55
29 0.58
30 0.57
31 0.54
32 0.51
33 0.43
34 0.35
35 0.31
36 0.27
37 0.2
38 0.11
39 0.07
40 0.06
41 0.05
42 0.07
43 0.07
44 0.08
45 0.08
46 0.09
47 0.09
48 0.1
49 0.1
50 0.1
51 0.14
52 0.17
53 0.16
54 0.19
55 0.18
56 0.17
57 0.17
58 0.17
59 0.13
60 0.13
61 0.15
62 0.15
63 0.23
64 0.29
65 0.39
66 0.42
67 0.47
68 0.54
69 0.59
70 0.57
71 0.58
72 0.6
73 0.58
74 0.58
75 0.57
76 0.53
77 0.47
78 0.45
79 0.38
80 0.31
81 0.21
82 0.18
83 0.15
84 0.13
85 0.2