Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5GQA9

Protein Details
Accession V5GQA9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
220-265ECNSNFCWKKACRPKRANGRTCNSAATCESGNCRYNRRTKISKCRAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR006796  Dickkopf_N  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030178  P:negative regulation of Wnt signaling pathway  
Pfam View protein in Pfam  
PF04706  Dickkopf_N  
Amino Acid Sequences MRASIRSALIFAAAAVVALQVAQPASAHLVDREVFENIAPSLYNYQRRQEGATAVPTTTTRTAAPTQTAGAGCKADGDCAEGYMCDTSAGKCVPNKGEGQPGFYCTGDNQCASNYYCYRGSCETVKQAGQNCYKDNGCLSGSCVNKRCAEPKTVPAGAACSQSTDCRPGYFCGNRTCKPQQGGGAACYKNQGCINNICVDGKCSSQGLNKDGSACFNNSECNSNFCWKKACRPKRANGRTCNSAATCESGNCRYNRRTKISKCRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.08
13 0.09
14 0.1
15 0.09
16 0.12
17 0.13
18 0.15
19 0.16
20 0.15
21 0.14
22 0.13
23 0.15
24 0.12
25 0.12
26 0.1
27 0.1
28 0.15
29 0.2
30 0.29
31 0.3
32 0.35
33 0.39
34 0.4
35 0.42
36 0.39
37 0.37
38 0.32
39 0.34
40 0.31
41 0.26
42 0.26
43 0.23
44 0.24
45 0.21
46 0.19
47 0.14
48 0.16
49 0.19
50 0.2
51 0.22
52 0.19
53 0.19
54 0.2
55 0.21
56 0.18
57 0.16
58 0.14
59 0.12
60 0.14
61 0.13
62 0.11
63 0.1
64 0.12
65 0.1
66 0.11
67 0.11
68 0.08
69 0.09
70 0.08
71 0.08
72 0.06
73 0.06
74 0.06
75 0.09
76 0.1
77 0.11
78 0.12
79 0.16
80 0.17
81 0.19
82 0.22
83 0.21
84 0.29
85 0.28
86 0.31
87 0.28
88 0.29
89 0.28
90 0.25
91 0.23
92 0.15
93 0.18
94 0.15
95 0.15
96 0.13
97 0.11
98 0.14
99 0.15
100 0.19
101 0.15
102 0.17
103 0.19
104 0.19
105 0.22
106 0.21
107 0.22
108 0.2
109 0.22
110 0.23
111 0.22
112 0.23
113 0.23
114 0.25
115 0.3
116 0.33
117 0.33
118 0.3
119 0.31
120 0.3
121 0.27
122 0.23
123 0.18
124 0.13
125 0.11
126 0.13
127 0.16
128 0.18
129 0.21
130 0.24
131 0.24
132 0.27
133 0.28
134 0.31
135 0.27
136 0.3
137 0.29
138 0.32
139 0.36
140 0.34
141 0.32
142 0.27
143 0.28
144 0.24
145 0.24
146 0.18
147 0.13
148 0.13
149 0.14
150 0.16
151 0.16
152 0.15
153 0.14
154 0.16
155 0.16
156 0.23
157 0.26
158 0.29
159 0.35
160 0.41
161 0.42
162 0.48
163 0.51
164 0.49
165 0.47
166 0.46
167 0.41
168 0.4
169 0.4
170 0.35
171 0.38
172 0.32
173 0.3
174 0.3
175 0.26
176 0.24
177 0.25
178 0.24
179 0.2
180 0.22
181 0.25
182 0.25
183 0.26
184 0.24
185 0.21
186 0.22
187 0.2
188 0.18
189 0.16
190 0.14
191 0.15
192 0.19
193 0.23
194 0.23
195 0.25
196 0.25
197 0.26
198 0.26
199 0.27
200 0.25
201 0.22
202 0.21
203 0.19
204 0.23
205 0.21
206 0.26
207 0.24
208 0.25
209 0.27
210 0.34
211 0.35
212 0.32
213 0.4
214 0.38
215 0.48
216 0.55
217 0.62
218 0.65
219 0.72
220 0.8
221 0.83
222 0.91
223 0.9
224 0.89
225 0.86
226 0.82
227 0.75
228 0.71
229 0.6
230 0.52
231 0.44
232 0.37
233 0.31
234 0.27
235 0.29
236 0.29
237 0.35
238 0.34
239 0.41
240 0.46
241 0.54
242 0.6
243 0.64
244 0.69
245 0.74