Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5ES56

Protein Details
Accession V5ES56    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-98KHDRGFRKSVHKVPKWTRLTBasic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGGAFKPSLPSLGGLLWKNPWRLSATRKSRVRTRLRAVDDVIATLTKSNVECHALQRALALPREEHMLAKDKYTTFSKHDRGFRKSVHKVPKWTRLTIRENPVGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.19
4 0.23
5 0.27
6 0.28
7 0.27
8 0.27
9 0.27
10 0.3
11 0.37
12 0.42
13 0.47
14 0.54
15 0.6
16 0.63
17 0.66
18 0.72
19 0.74
20 0.72
21 0.71
22 0.7
23 0.69
24 0.67
25 0.6
26 0.54
27 0.44
28 0.35
29 0.27
30 0.18
31 0.13
32 0.1
33 0.08
34 0.06
35 0.06
36 0.07
37 0.07
38 0.1
39 0.11
40 0.12
41 0.16
42 0.15
43 0.15
44 0.14
45 0.16
46 0.16
47 0.17
48 0.16
49 0.12
50 0.13
51 0.16
52 0.15
53 0.13
54 0.13
55 0.19
56 0.18
57 0.19
58 0.22
59 0.19
60 0.23
61 0.26
62 0.27
63 0.24
64 0.33
65 0.39
66 0.42
67 0.5
68 0.55
69 0.58
70 0.61
71 0.63
72 0.65
73 0.66
74 0.68
75 0.7
76 0.7
77 0.74
78 0.77
79 0.8
80 0.75
81 0.74
82 0.73
83 0.72
84 0.73
85 0.71
86 0.71