Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5EZ89

Protein Details
Accession V5EZ89   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-108KVSVKKNKDLPTKMKKNHSPEQAKKVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSTKPRSDSSSSTSSTDPYANASVFRASPNYKSDHLDDLSHGSTAKAHRWSGGKKNPGSGRSHVEARLTGADQINPSRQENKVSVKKNKDLPTKMKKNHSPEQAKKVLEAMSRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.28
4 0.21
5 0.19
6 0.19
7 0.16
8 0.16
9 0.17
10 0.16
11 0.15
12 0.16
13 0.17
14 0.16
15 0.19
16 0.22
17 0.25
18 0.25
19 0.28
20 0.29
21 0.3
22 0.29
23 0.26
24 0.24
25 0.24
26 0.22
27 0.19
28 0.17
29 0.12
30 0.13
31 0.14
32 0.17
33 0.17
34 0.16
35 0.19
36 0.24
37 0.28
38 0.35
39 0.41
40 0.44
41 0.41
42 0.48
43 0.49
44 0.48
45 0.47
46 0.4
47 0.37
48 0.33
49 0.35
50 0.29
51 0.26
52 0.23
53 0.2
54 0.19
55 0.15
56 0.14
57 0.12
58 0.12
59 0.13
60 0.15
61 0.17
62 0.18
63 0.19
64 0.21
65 0.21
66 0.24
67 0.27
68 0.35
69 0.4
70 0.46
71 0.54
72 0.58
73 0.63
74 0.68
75 0.72
76 0.72
77 0.72
78 0.73
79 0.76
80 0.79
81 0.8
82 0.82
83 0.81
84 0.8
85 0.81
86 0.81
87 0.81
88 0.79
89 0.81
90 0.78
91 0.71
92 0.63
93 0.58
94 0.52