Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5EYH3

Protein Details
Accession V5EYH3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
171-198EKVEQRGSRRSLKKQAKREAKKISAKQEHydrophilic
NLS Segment(s)
PositionSequence
176-196RGSRRSLKKQAKREAKKISAK
Subcellular Location(s) plas 9, mito 6, E.R. 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLEVTPPTRIPMFPANYREFLIAPAAPRVPTALQTLQPGEIFQLAQPKWPIAHTQPSFYALALTTIVAAFFLLAFKDVAALINYELRTRLRIPGNPVVGTVLGLLAATMLCITYENDVRKRSGYYPEGADPRQMVWLSGGATVCAILWASSTFQSPIKARDEQTEKKVVEEKVEQRGSRRSLKKQAKREAKKISAKQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.45
4 0.46
5 0.43
6 0.34
7 0.3
8 0.26
9 0.21
10 0.17
11 0.19
12 0.19
13 0.17
14 0.17
15 0.19
16 0.16
17 0.17
18 0.21
19 0.2
20 0.21
21 0.24
22 0.25
23 0.24
24 0.23
25 0.21
26 0.16
27 0.14
28 0.12
29 0.1
30 0.17
31 0.16
32 0.2
33 0.21
34 0.2
35 0.2
36 0.21
37 0.24
38 0.2
39 0.3
40 0.28
41 0.3
42 0.3
43 0.32
44 0.31
45 0.27
46 0.24
47 0.14
48 0.13
49 0.1
50 0.09
51 0.06
52 0.06
53 0.06
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.05
69 0.08
70 0.09
71 0.08
72 0.1
73 0.09
74 0.11
75 0.12
76 0.17
77 0.18
78 0.21
79 0.26
80 0.31
81 0.33
82 0.31
83 0.3
84 0.25
85 0.21
86 0.18
87 0.12
88 0.06
89 0.04
90 0.03
91 0.03
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.03
99 0.03
100 0.05
101 0.09
102 0.13
103 0.17
104 0.19
105 0.2
106 0.2
107 0.23
108 0.23
109 0.27
110 0.26
111 0.25
112 0.26
113 0.3
114 0.33
115 0.31
116 0.29
117 0.23
118 0.21
119 0.22
120 0.19
121 0.14
122 0.11
123 0.12
124 0.12
125 0.13
126 0.12
127 0.09
128 0.09
129 0.08
130 0.07
131 0.06
132 0.05
133 0.03
134 0.04
135 0.05
136 0.06
137 0.07
138 0.08
139 0.1
140 0.11
141 0.15
142 0.17
143 0.2
144 0.24
145 0.28
146 0.28
147 0.35
148 0.42
149 0.45
150 0.49
151 0.53
152 0.48
153 0.47
154 0.52
155 0.44
156 0.42
157 0.44
158 0.43
159 0.45
160 0.51
161 0.49
162 0.47
163 0.54
164 0.54
165 0.57
166 0.59
167 0.59
168 0.64
169 0.74
170 0.79
171 0.81
172 0.86
173 0.88
174 0.89
175 0.9
176 0.89
177 0.88
178 0.89