Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5F1Y1

Protein Details
Accession V5F1Y1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MLYKASKKNQQHQVPYQPIAHydrophilic
372-400QSSSWSRTAKRRREKKELEKREKEQRFRGBasic
NLS Segment(s)
PositionSequence
380-397AKRRREKKELEKREKEQR
Subcellular Location(s) mito 12, nucl 6.5, cyto_nucl 5.5, extr 4, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLYKASKKNQQHQVPYQPIAAAPPMSSGHSSHASSWGGAAVGGAAVAAAGAAYAAHHHQQQQNRPPNPNANPAAVAANNPNLGWESLRDWKHIASLLAACVMDQYLYPFYTFADVARIAQHIASSGALQQCADSWQLPPYLAQDLVKLALFDVMFLLDDSASMRSEGTRRRDSLAGILKRAADAAARFDPDGMEVAWMNAPAQQRIHNVAEADQLTSRCAYDGRSTPMGSSLEAKILQPLVLSPATQGRLQKPAFVLIITDGRPTGSAESNNKIVRVLQSAKRTLASTRYGEDAISFQIAAVGNDREAQEWLDSIDNDPTVGDLIDVCSDIAVESKQVKKSTGIELTPELYCLKLLLGPIDTSYDASDENEQSSSWSRTAKRRREKKELEKREKEQRFRGQMETFKRERDAALNGATPLPSAGGALPPQGADAGLSGYSHQPSYPAGGPPQPQGGYPQPGGYQQQQPYPPPQSSYGPPPTAGYPSAPQNTSYPPYGAPQGAPPPYPNPYQNQPQYGQRDMQPGGGSSYPAPGGGGFVPGAGGFAMPNPHFGGAGQGQGGYGQYGEQQGQGQAPPFGFPQAKPSGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.77
3 0.68
4 0.59
5 0.49
6 0.42
7 0.35
8 0.25
9 0.17
10 0.17
11 0.17
12 0.18
13 0.2
14 0.18
15 0.2
16 0.24
17 0.25
18 0.23
19 0.28
20 0.26
21 0.25
22 0.24
23 0.2
24 0.15
25 0.14
26 0.12
27 0.07
28 0.05
29 0.05
30 0.04
31 0.03
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.04
41 0.06
42 0.09
43 0.12
44 0.18
45 0.24
46 0.33
47 0.43
48 0.52
49 0.61
50 0.65
51 0.69
52 0.71
53 0.75
54 0.72
55 0.71
56 0.64
57 0.56
58 0.51
59 0.45
60 0.41
61 0.31
62 0.28
63 0.21
64 0.21
65 0.19
66 0.17
67 0.17
68 0.15
69 0.15
70 0.14
71 0.14
72 0.15
73 0.23
74 0.24
75 0.26
76 0.26
77 0.26
78 0.28
79 0.29
80 0.25
81 0.2
82 0.2
83 0.18
84 0.19
85 0.18
86 0.14
87 0.12
88 0.12
89 0.08
90 0.07
91 0.09
92 0.09
93 0.1
94 0.1
95 0.1
96 0.1
97 0.13
98 0.13
99 0.1
100 0.12
101 0.12
102 0.13
103 0.14
104 0.15
105 0.13
106 0.13
107 0.12
108 0.09
109 0.09
110 0.09
111 0.08
112 0.11
113 0.12
114 0.12
115 0.12
116 0.11
117 0.11
118 0.12
119 0.13
120 0.1
121 0.1
122 0.12
123 0.13
124 0.13
125 0.13
126 0.14
127 0.15
128 0.15
129 0.15
130 0.13
131 0.13
132 0.14
133 0.13
134 0.11
135 0.09
136 0.1
137 0.1
138 0.09
139 0.08
140 0.07
141 0.07
142 0.07
143 0.07
144 0.04
145 0.04
146 0.05
147 0.06
148 0.06
149 0.06
150 0.07
151 0.08
152 0.13
153 0.2
154 0.27
155 0.32
156 0.33
157 0.37
158 0.38
159 0.37
160 0.41
161 0.43
162 0.39
163 0.34
164 0.34
165 0.3
166 0.29
167 0.28
168 0.2
169 0.12
170 0.1
171 0.13
172 0.14
173 0.15
174 0.14
175 0.14
176 0.14
177 0.13
178 0.13
179 0.08
180 0.07
181 0.06
182 0.07
183 0.07
184 0.07
185 0.07
186 0.09
187 0.1
188 0.11
189 0.12
190 0.14
191 0.16
192 0.21
193 0.22
194 0.2
195 0.2
196 0.19
197 0.22
198 0.19
199 0.18
200 0.15
201 0.14
202 0.13
203 0.13
204 0.12
205 0.09
206 0.09
207 0.1
208 0.13
209 0.16
210 0.21
211 0.23
212 0.23
213 0.23
214 0.26
215 0.24
216 0.2
217 0.18
218 0.14
219 0.14
220 0.14
221 0.14
222 0.12
223 0.11
224 0.11
225 0.08
226 0.08
227 0.09
228 0.08
229 0.08
230 0.08
231 0.1
232 0.12
233 0.14
234 0.16
235 0.16
236 0.23
237 0.23
238 0.25
239 0.22
240 0.23
241 0.22
242 0.19
243 0.17
244 0.11
245 0.14
246 0.11
247 0.11
248 0.09
249 0.08
250 0.09
251 0.09
252 0.1
253 0.09
254 0.12
255 0.15
256 0.17
257 0.22
258 0.22
259 0.22
260 0.2
261 0.19
262 0.17
263 0.19
264 0.21
265 0.21
266 0.26
267 0.28
268 0.29
269 0.28
270 0.28
271 0.24
272 0.24
273 0.23
274 0.19
275 0.18
276 0.19
277 0.18
278 0.17
279 0.16
280 0.13
281 0.09
282 0.08
283 0.07
284 0.05
285 0.07
286 0.07
287 0.07
288 0.07
289 0.07
290 0.07
291 0.09
292 0.09
293 0.08
294 0.08
295 0.09
296 0.07
297 0.07
298 0.08
299 0.07
300 0.07
301 0.07
302 0.08
303 0.07
304 0.07
305 0.07
306 0.06
307 0.05
308 0.05
309 0.04
310 0.03
311 0.04
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.04
319 0.04
320 0.05
321 0.09
322 0.13
323 0.17
324 0.18
325 0.19
326 0.2
327 0.23
328 0.28
329 0.29
330 0.25
331 0.23
332 0.24
333 0.25
334 0.22
335 0.2
336 0.14
337 0.1
338 0.1
339 0.08
340 0.07
341 0.06
342 0.06
343 0.07
344 0.07
345 0.07
346 0.08
347 0.09
348 0.09
349 0.08
350 0.08
351 0.08
352 0.07
353 0.08
354 0.1
355 0.09
356 0.1
357 0.1
358 0.1
359 0.11
360 0.14
361 0.15
362 0.14
363 0.19
364 0.22
365 0.32
366 0.42
367 0.51
368 0.58
369 0.66
370 0.74
371 0.8
372 0.86
373 0.88
374 0.89
375 0.9
376 0.9
377 0.89
378 0.87
379 0.87
380 0.85
381 0.8
382 0.78
383 0.76
384 0.74
385 0.68
386 0.68
387 0.62
388 0.6
389 0.61
390 0.59
391 0.51
392 0.45
393 0.43
394 0.39
395 0.35
396 0.31
397 0.27
398 0.22
399 0.22
400 0.22
401 0.21
402 0.2
403 0.19
404 0.15
405 0.11
406 0.09
407 0.06
408 0.05
409 0.05
410 0.06
411 0.07
412 0.08
413 0.08
414 0.07
415 0.07
416 0.07
417 0.07
418 0.05
419 0.05
420 0.05
421 0.05
422 0.05
423 0.06
424 0.08
425 0.09
426 0.09
427 0.09
428 0.09
429 0.1
430 0.14
431 0.16
432 0.17
433 0.18
434 0.22
435 0.25
436 0.26
437 0.3
438 0.26
439 0.23
440 0.26
441 0.29
442 0.3
443 0.28
444 0.28
445 0.24
446 0.27
447 0.3
448 0.3
449 0.32
450 0.3
451 0.36
452 0.38
453 0.4
454 0.44
455 0.46
456 0.42
457 0.38
458 0.39
459 0.37
460 0.37
461 0.42
462 0.43
463 0.39
464 0.38
465 0.36
466 0.35
467 0.33
468 0.31
469 0.25
470 0.2
471 0.26
472 0.3
473 0.29
474 0.29
475 0.28
476 0.32
477 0.33
478 0.32
479 0.26
480 0.23
481 0.25
482 0.27
483 0.25
484 0.21
485 0.23
486 0.28
487 0.29
488 0.29
489 0.29
490 0.3
491 0.32
492 0.36
493 0.34
494 0.33
495 0.38
496 0.46
497 0.5
498 0.52
499 0.52
500 0.56
501 0.59
502 0.57
503 0.54
504 0.48
505 0.48
506 0.43
507 0.43
508 0.36
509 0.31
510 0.3
511 0.27
512 0.24
513 0.18
514 0.19
515 0.15
516 0.14
517 0.13
518 0.1
519 0.11
520 0.1
521 0.11
522 0.09
523 0.08
524 0.09
525 0.08
526 0.09
527 0.06
528 0.06
529 0.04
530 0.06
531 0.12
532 0.12
533 0.14
534 0.15
535 0.16
536 0.16
537 0.16
538 0.21
539 0.17
540 0.19
541 0.17
542 0.15
543 0.15
544 0.15
545 0.15
546 0.09
547 0.08
548 0.06
549 0.08
550 0.1
551 0.11
552 0.13
553 0.14
554 0.15
555 0.18
556 0.19
557 0.19
558 0.2
559 0.19
560 0.19
561 0.19
562 0.23
563 0.24
564 0.22
565 0.28