Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5EU32

Protein Details
Accession V5EU32   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTRTRHGKKTHHARRDVKRAMRTRARKLDPBasic
NLS Segment(s)
PositionSequence
5-27RHGKKTHHARRDVKRAMRTRARK
88-89RR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MTRTRHGKKTHHARRDVKRAMRTRARKLDPDQIQANLNDPKKLEDLQNPKELDVDKAGLGLFYCVECDRNFPSQKDQLTHIASKLHKRRAKKITEEPAYTIEESLRAVGMGIDNKQRAPKTAEPAKDMAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.85
5 0.84
6 0.82
7 0.82
8 0.83
9 0.81
10 0.8
11 0.81
12 0.78
13 0.76
14 0.73
15 0.74
16 0.68
17 0.66
18 0.58
19 0.49
20 0.46
21 0.39
22 0.38
23 0.35
24 0.3
25 0.26
26 0.23
27 0.24
28 0.24
29 0.25
30 0.24
31 0.26
32 0.33
33 0.36
34 0.43
35 0.41
36 0.39
37 0.39
38 0.36
39 0.29
40 0.22
41 0.18
42 0.11
43 0.11
44 0.11
45 0.09
46 0.08
47 0.06
48 0.05
49 0.04
50 0.05
51 0.04
52 0.06
53 0.06
54 0.08
55 0.11
56 0.18
57 0.2
58 0.21
59 0.27
60 0.31
61 0.33
62 0.32
63 0.32
64 0.31
65 0.32
66 0.32
67 0.27
68 0.28
69 0.28
70 0.35
71 0.4
72 0.44
73 0.45
74 0.49
75 0.58
76 0.62
77 0.68
78 0.68
79 0.71
80 0.71
81 0.74
82 0.71
83 0.64
84 0.57
85 0.52
86 0.43
87 0.33
88 0.23
89 0.16
90 0.15
91 0.13
92 0.09
93 0.06
94 0.06
95 0.06
96 0.08
97 0.1
98 0.13
99 0.18
100 0.19
101 0.21
102 0.27
103 0.28
104 0.29
105 0.35
106 0.39
107 0.43
108 0.5
109 0.54
110 0.52