Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AE83

Protein Details
Accession B2AE83    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-110ALTCPSGKGEKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKDDELGTGEBasic
NLS Segment(s)
PositionSequence
27-102KGEKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKK
Subcellular Location(s) nucl 14, mito 7, cyto 5
Family & Domain DBs
KEGG pan:PODANSg0989  -  
Amino Acid Sequences MGSPWEALPIRSSLPGAITALTCPSGKGEKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKKDKKDDELGTGEAQDEEGDTGAWCRNLQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.13
5 0.11
6 0.11
7 0.11
8 0.12
9 0.11
10 0.1
11 0.12
12 0.19
13 0.22
14 0.28
15 0.38
16 0.46
17 0.57
18 0.68
19 0.76
20 0.8
21 0.88
22 0.92
23 0.93
24 0.94
25 0.95
26 0.95
27 0.96
28 0.96
29 0.97
30 0.97
31 0.97
32 0.97
33 0.97
34 0.97
35 0.97
36 0.97
37 0.97
38 0.97
39 0.97
40 0.97
41 0.97
42 0.97
43 0.97
44 0.97
45 0.97
46 0.97
47 0.97
48 0.97
49 0.97
50 0.97
51 0.97
52 0.97
53 0.97
54 0.97
55 0.97
56 0.97
57 0.97
58 0.97
59 0.97
60 0.97
61 0.97
62 0.97
63 0.97
64 0.97
65 0.97
66 0.97
67 0.97
68 0.97
69 0.97
70 0.97
71 0.97
72 0.97
73 0.97
74 0.97
75 0.97
76 0.97
77 0.97
78 0.97
79 0.97
80 0.97
81 0.97
82 0.97
83 0.97
84 0.97
85 0.97
86 0.97
87 0.96
88 0.95
89 0.93
90 0.88
91 0.82
92 0.75
93 0.66
94 0.55
95 0.45
96 0.34
97 0.25
98 0.18
99 0.12
100 0.09
101 0.07
102 0.06
103 0.06
104 0.06
105 0.08
106 0.1
107 0.11