Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5EWF1

Protein Details
Accession V5EWF1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-100SKRYLKYLTKKHLRKQQLRDWLRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, mito 10, cyto_nucl 7, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAVTKTTKASAKQGKTAHKFFIDFSGPANDGILDAAAFEKYLHDRIKVDGKAGNLGDHVKITREGEGKIWVNTNVAFSKRYLKYLTKKHLRKQQLRDWLRVVATSKDGYEIKFFNVSYDQEEAEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.67
4 0.62
5 0.56
6 0.52
7 0.45
8 0.44
9 0.37
10 0.29
11 0.27
12 0.26
13 0.24
14 0.22
15 0.22
16 0.15
17 0.12
18 0.11
19 0.09
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.07
28 0.12
29 0.13
30 0.14
31 0.15
32 0.18
33 0.26
34 0.25
35 0.25
36 0.23
37 0.22
38 0.24
39 0.23
40 0.21
41 0.14
42 0.14
43 0.13
44 0.11
45 0.11
46 0.08
47 0.09
48 0.09
49 0.11
50 0.12
51 0.12
52 0.13
53 0.17
54 0.17
55 0.17
56 0.18
57 0.15
58 0.14
59 0.14
60 0.15
61 0.12
62 0.13
63 0.13
64 0.12
65 0.21
66 0.21
67 0.24
68 0.25
69 0.31
70 0.38
71 0.47
72 0.57
73 0.59
74 0.65
75 0.71
76 0.77
77 0.8
78 0.81
79 0.81
80 0.8
81 0.8
82 0.77
83 0.74
84 0.67
85 0.6
86 0.51
87 0.44
88 0.38
89 0.29
90 0.28
91 0.24
92 0.21
93 0.22
94 0.22
95 0.21
96 0.23
97 0.21
98 0.21
99 0.24
100 0.23
101 0.22
102 0.24
103 0.25
104 0.24
105 0.25