Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5E610

Protein Details
Accession V5E610   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-131LAEKTEKASRKLRKERKNRAKKVRGTKKVKASEAABasic
NLS Segment(s)
PositionSequence
98-134AEKTEKASRKLRKERKNRAKKVRGTKKVKASEAAKKK
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDSTSPVTLRTRKFITNRLLQRKQMVLDVIHPARPNVSKAELSEKLSEMYKTPKEQCIVFGMRTAFGGGRSTGFALVYDSRESMKFEPKHRLVRVGLAEKTEKASRKLRKERKNRAKKVRGTKKVKASEAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.59
4 0.66
5 0.7
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.33
16 0.29
17 0.28
18 0.26
19 0.23
20 0.24
21 0.25
22 0.24
23 0.19
24 0.21
25 0.2
26 0.21
27 0.29
28 0.28
29 0.3
30 0.3
31 0.27
32 0.25
33 0.24
34 0.23
35 0.17
36 0.2
37 0.21
38 0.24
39 0.26
40 0.28
41 0.29
42 0.29
43 0.29
44 0.28
45 0.27
46 0.22
47 0.22
48 0.19
49 0.17
50 0.17
51 0.16
52 0.1
53 0.08
54 0.09
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.13
70 0.13
71 0.22
72 0.25
73 0.28
74 0.37
75 0.42
76 0.51
77 0.49
78 0.53
79 0.45
80 0.46
81 0.49
82 0.45
83 0.4
84 0.34
85 0.35
86 0.3
87 0.33
88 0.31
89 0.28
90 0.28
91 0.36
92 0.42
93 0.52
94 0.62
95 0.69
96 0.74
97 0.83
98 0.89
99 0.91
100 0.94
101 0.94
102 0.94
103 0.94
104 0.93
105 0.93
106 0.93
107 0.93
108 0.9
109 0.89
110 0.88
111 0.87
112 0.81
113 0.78
114 0.74