Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B3F8

Protein Details
Accession B2B3F8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
338-361EAAWSLAPKKKQKSVRETFKEMVRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 12
Family & Domain DBs
KEGG pan:PODANSg7547  -  
Amino Acid Sequences MDPFSIGIGCITLLEVAQKTIKQLYQLSKRYNDARSDLLKTMTQLRSLAYVLELIRYDEGTQHTDSPNRKNDLIMDQVNLCMDIIEELQVVITSINDSRVKWAISGKAAVENIHKQLQTATEQLELTLGVHTLAVAKDIKKDATELLLGQEQIGAQVQRLSEHMGLRDNTGPSHRSSPTTIPSWSRTSQGVCVEASGQCDSSVGAMAGIHESVNDGNYTNDTPSPTNSSQWSGSTAYSPPASISSPISVIDVTATLVTPNVNPIYHHTAETGSWSQYQDPATVAPDTPDITFWPSEMQYSPTTMAHKTAKLSKEITVEHVETPTAPSKEEVIRNQFKEAAWSLAPKKKQKSVRETFKEMVRLKAAASVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.14
5 0.14
6 0.17
7 0.21
8 0.23
9 0.24
10 0.3
11 0.38
12 0.46
13 0.53
14 0.58
15 0.58
16 0.63
17 0.65
18 0.64
19 0.6
20 0.53
21 0.52
22 0.5
23 0.5
24 0.46
25 0.42
26 0.37
27 0.34
28 0.39
29 0.34
30 0.32
31 0.27
32 0.26
33 0.25
34 0.24
35 0.23
36 0.14
37 0.15
38 0.13
39 0.15
40 0.14
41 0.13
42 0.13
43 0.13
44 0.13
45 0.14
46 0.16
47 0.17
48 0.19
49 0.21
50 0.23
51 0.28
52 0.33
53 0.38
54 0.44
55 0.45
56 0.44
57 0.41
58 0.43
59 0.42
60 0.43
61 0.36
62 0.3
63 0.26
64 0.26
65 0.25
66 0.21
67 0.16
68 0.09
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.05
81 0.05
82 0.1
83 0.12
84 0.12
85 0.15
86 0.18
87 0.19
88 0.19
89 0.22
90 0.21
91 0.21
92 0.23
93 0.2
94 0.22
95 0.22
96 0.22
97 0.22
98 0.22
99 0.23
100 0.25
101 0.24
102 0.2
103 0.21
104 0.22
105 0.21
106 0.2
107 0.18
108 0.16
109 0.16
110 0.15
111 0.14
112 0.12
113 0.09
114 0.08
115 0.07
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.07
122 0.08
123 0.09
124 0.12
125 0.13
126 0.14
127 0.13
128 0.14
129 0.13
130 0.13
131 0.13
132 0.1
133 0.11
134 0.12
135 0.11
136 0.1
137 0.1
138 0.08
139 0.07
140 0.08
141 0.06
142 0.05
143 0.07
144 0.07
145 0.07
146 0.08
147 0.1
148 0.11
149 0.12
150 0.13
151 0.15
152 0.15
153 0.17
154 0.19
155 0.16
156 0.15
157 0.16
158 0.17
159 0.15
160 0.19
161 0.18
162 0.18
163 0.2
164 0.22
165 0.24
166 0.25
167 0.25
168 0.22
169 0.25
170 0.27
171 0.26
172 0.24
173 0.23
174 0.21
175 0.23
176 0.22
177 0.2
178 0.15
179 0.15
180 0.14
181 0.13
182 0.13
183 0.11
184 0.09
185 0.08
186 0.08
187 0.07
188 0.07
189 0.06
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.03
198 0.04
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.07
206 0.08
207 0.09
208 0.1
209 0.11
210 0.12
211 0.19
212 0.19
213 0.2
214 0.21
215 0.22
216 0.22
217 0.22
218 0.23
219 0.18
220 0.17
221 0.17
222 0.16
223 0.15
224 0.14
225 0.13
226 0.11
227 0.11
228 0.11
229 0.11
230 0.11
231 0.1
232 0.11
233 0.11
234 0.11
235 0.09
236 0.09
237 0.08
238 0.06
239 0.06
240 0.05
241 0.05
242 0.04
243 0.05
244 0.05
245 0.05
246 0.08
247 0.09
248 0.09
249 0.09
250 0.15
251 0.22
252 0.23
253 0.24
254 0.22
255 0.22
256 0.21
257 0.26
258 0.23
259 0.16
260 0.17
261 0.18
262 0.18
263 0.2
264 0.21
265 0.16
266 0.15
267 0.15
268 0.15
269 0.15
270 0.14
271 0.12
272 0.12
273 0.13
274 0.12
275 0.12
276 0.11
277 0.13
278 0.13
279 0.12
280 0.14
281 0.13
282 0.15
283 0.15
284 0.17
285 0.15
286 0.18
287 0.2
288 0.19
289 0.21
290 0.2
291 0.24
292 0.25
293 0.26
294 0.28
295 0.34
296 0.35
297 0.37
298 0.38
299 0.37
300 0.38
301 0.37
302 0.38
303 0.36
304 0.35
305 0.32
306 0.3
307 0.26
308 0.21
309 0.24
310 0.26
311 0.21
312 0.2
313 0.2
314 0.23
315 0.3
316 0.36
317 0.39
318 0.42
319 0.5
320 0.52
321 0.54
322 0.53
323 0.46
324 0.46
325 0.4
326 0.35
327 0.28
328 0.32
329 0.37
330 0.41
331 0.49
332 0.52
333 0.57
334 0.62
335 0.7
336 0.73
337 0.77
338 0.8
339 0.84
340 0.84
341 0.84
342 0.8
343 0.77
344 0.77
345 0.68
346 0.63
347 0.56
348 0.48
349 0.4
350 0.4