Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A090CHQ2

Protein Details
Accession A0A090CHQ2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGAKKQKKKWSKGKVKDKAQHAVILDKTTSDKLYKDVQSYRLVTVATLVDRLKINGSLARRCLADLEEKGQIKQVVSHSKMKIYTRAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.4
16 0.35
17 0.28
18 0.2
19 0.2
20 0.17
21 0.17
22 0.13
23 0.12
24 0.13
25 0.2
26 0.22
27 0.24
28 0.26
29 0.28
30 0.31
31 0.32
32 0.3
33 0.24
34 0.22
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.17
50 0.18
51 0.2
52 0.19
53 0.19
54 0.19
55 0.17
56 0.2
57 0.18
58 0.2
59 0.25
60 0.25
61 0.25
62 0.28
63 0.28
64 0.22
65 0.24
66 0.28
67 0.31
68 0.35
69 0.43
70 0.41
71 0.44
72 0.49
73 0.48
74 0.49
75 0.45
76 0.45
77 0.41