FuNGI

Q59MD2

Protein Details

Accession

Q59MD2

Localization Confidence

High

Confidence Score

23.2

NoLS Segment(s)

Position	Sequence	Protein Nature
623-653	SSTLSNKKVVKKLRGRKSKTKMNKSSIKTEQ	Hydrophilic
743-778	STSTSNPMVKKKHTRRRLLPRSKKGCWICRIKHLKC	Hydrophilic
816-843	TEVSLIRKRNQAKTKISRKKSSNDITND	Hydrophilic

NLS Segment(s)

Position	Sequence
629-644	KKVVKKLRGRKSKTKM
752-766	KKKHTRRRLLPRSKK
824-834	RNQAKTKISRK

Subcellular Location(s)

nucl 24, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0003677 F:DNA binding GO:0003700 F:DNA-binding transcription factor activity GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding GO:0007155 P:cell adhesion GO:0071244 P:cellular response to carbon dioxide GO:0036244 P:cellular response to neutral pH GO:0009267 P:cellular response to starvation GO:0030447 P:filamentous growth GO:0044182 P:filamentous growth of a population of unicellular organisms GO:0036180 P:filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:0036178 P:filamentous growth of a population of unicellular organisms in response to neutral pH GO:0036170 P:filamentous growth of a population of unicellular organisms in response to starvation GO:1900430 P:positive regulation of filamentous growth of a population of unicellular organisms GO:1900445 P:positive regulation of filamentous growth of a population of unicellular organisms in response to biotic stimulus GO:1900442 P:positive regulation of filamentous growth of a population of unicellular organisms in response to neutral pH GO:1900436 P:positive regulation of filamentous growth of a population of unicellular organisms in response to starvation GO:0006355 P:regulation of DNA-templated transcription
KEGG	cal:CAALFM_C106280CA -
Pfam	View protein in Pfam PF00172 Zn_clus
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4

Amino Acid Sequences

MITHMVTPDSTSSAPNSPYGEDTIKLNSSVISSSSPVRSTSYLQNLQLQQQFSQLQFLQLQQQQQQQDQQLALQQQQQQQQSQSQQAQPYANPYFQTPIDQLFQFDNNPNSSFNPTRPPNIHTNQPYVSPYLHSAPLTNHSDLQPQPPPASLSDSELGLGLVKQQQDSLPPQQQAQSQPTPLLNQQHPFYNEYINDMPSTQHPYLIFNNTNAAHSTTSLPNLDAANPSSILPQSALNQSEYYKVTNGSMSNDPQPSTFLYNLHNHSADLVMNNDLEFSNASFDSIGGVSVSAAATGAGAGAGDYSHTNITSNFAQTNLHSSSQQSGVLPPPPSLPPPPTSLPSQQSQNQYLDVVPPQQLTNNALKTEANSPLITDSANFTTSQPQFENTILEQSPIFSNNTILSGIDEPSKEKSPNMLNSTLPLSKSTPHHIYQPSSSSSSHVRHNKITKKSSLSRLNTSSKKNLRANLVHSLSTPTELDDANNNNNDIVTPPKTLSPLLRKKTSFINVKKENDIDDSHDINCKNFSIDIDDMDDEDVLSDFSQPPPPIGGVSNDTMRSLAPVGGVGLGSSGNITGYRSLSNASSTSSHGSHHGLPVMNIFRHNPDSTKPSTPSPILSTASSSSTLSNKKVVKKLRGRKSKTKMNKSSIKTEQVVNEEPQVKNYKDDNDNDNDNGHGHDHDDENGGVSSDVGTGSNSTPSTTTKGKKMKLNVDLNNGGGSGTGSGSCSDENTSGNGTNTNTDSTSTSNPMVKKKHTRRRLLPRSKKGCWICRIKHLKCDEVTPICGGCAKFGLQCDYSSEKPAYVTDKILRQKKLTEVSLIRKRNQAKTKISRKKSSNDITND

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.25
3	0.25
4	0.24
5	0.25
6	0.28
7	0.27
8	0.24
9	0.24
10	0.27
11	0.26
12	0.24
13	0.23
14	0.19
15	0.18
16	0.18
17	0.17
18	0.14
19	0.15
20	0.19
21	0.22
22	0.22
23	0.22
24	0.25
25	0.26
26	0.28
27	0.35
28	0.4
29	0.42
30	0.43
31	0.5
32	0.49
33	0.54
34	0.54
35	0.47
36	0.38
37	0.38
38	0.39
39	0.31
40	0.35
41	0.28
42	0.26
43	0.26
44	0.27
45	0.3
46	0.3
47	0.35
48	0.34
49	0.4
50	0.41
51	0.43
52	0.48
53	0.43
54	0.43
55	0.39
56	0.35
57	0.33
58	0.33
59	0.32
60	0.31
61	0.34
62	0.36
63	0.43
64	0.45
65	0.44
66	0.45
67	0.48
68	0.48
69	0.5
70	0.51
71	0.49
72	0.49
73	0.5
74	0.49
75	0.43
76	0.45
77	0.41
78	0.36
79	0.32
80	0.29
81	0.29
82	0.26
83	0.29
84	0.23
85	0.23
86	0.25
87	0.24
88	0.24
89	0.23
90	0.24
91	0.23
92	0.27
93	0.27
94	0.27
95	0.28
96	0.28
97	0.28
98	0.33
99	0.33
100	0.31
101	0.36
102	0.37
103	0.43
104	0.45
105	0.47
106	0.5
107	0.51
108	0.57
109	0.53
110	0.56
111	0.49
112	0.49
113	0.46
114	0.39
115	0.36
116	0.29
117	0.27
118	0.24
119	0.25
120	0.22
121	0.22
122	0.22
123	0.28
124	0.31
125	0.29
126	0.28
127	0.26
128	0.32
129	0.31
130	0.35
131	0.34
132	0.32
133	0.31
134	0.3
135	0.31
136	0.27
137	0.31
138	0.26
139	0.24
140	0.23
141	0.22
142	0.2
143	0.19
144	0.17
145	0.11
146	0.1
147	0.09
148	0.11
149	0.11
150	0.11
151	0.12
152	0.13
153	0.17
154	0.23
155	0.28
156	0.31
157	0.32
158	0.33
159	0.36
160	0.4
161	0.41
162	0.43
163	0.39
164	0.34
165	0.35
166	0.35
167	0.34
168	0.34
169	0.35
170	0.32
171	0.32
172	0.32
173	0.36
174	0.37
175	0.37
176	0.34
177	0.31
178	0.27
179	0.29
180	0.29
181	0.24
182	0.22
183	0.2
184	0.19
185	0.17
186	0.25
187	0.19
188	0.2
189	0.2
190	0.23
191	0.27
192	0.32
193	0.31
194	0.24
195	0.29
196	0.27
197	0.27
198	0.25
199	0.23
200	0.17
201	0.16
202	0.19
203	0.16
204	0.18
205	0.17
206	0.16
207	0.16
208	0.16
209	0.16
210	0.15
211	0.14
212	0.13
213	0.13
214	0.14
215	0.13
216	0.13
217	0.12
218	0.11
219	0.11
220	0.12
221	0.16
222	0.17
223	0.17
224	0.17
225	0.18
226	0.2
227	0.2
228	0.19
229	0.16
230	0.15
231	0.15
232	0.17
233	0.17
234	0.17
235	0.19
236	0.2
237	0.24
238	0.25
239	0.24
240	0.22
241	0.23
242	0.21
243	0.21
244	0.2
245	0.16
246	0.19
247	0.24
248	0.27
249	0.28
250	0.27
251	0.23
252	0.22
253	0.22
254	0.18
255	0.13
256	0.11
257	0.09
258	0.09
259	0.09
260	0.09
261	0.08
262	0.08
263	0.07
264	0.06
265	0.08
266	0.07
267	0.08
268	0.07
269	0.07
270	0.08
271	0.07
272	0.07
273	0.05
274	0.05
275	0.04
276	0.05
277	0.05
278	0.03
279	0.03
280	0.03
281	0.03
282	0.03
283	0.03
284	0.02
285	0.02
286	0.02
287	0.02
288	0.02
289	0.03
290	0.03
291	0.04
292	0.05
293	0.05
294	0.06
295	0.06
296	0.1
297	0.1
298	0.12
299	0.11
300	0.11
301	0.12
302	0.12
303	0.17
304	0.16
305	0.15
306	0.14
307	0.15
308	0.17
309	0.18
310	0.18
311	0.13
312	0.13
313	0.14
314	0.18
315	0.18
316	0.16
317	0.17
318	0.17
319	0.19
320	0.2
321	0.2
322	0.18
323	0.22
324	0.24
325	0.24
326	0.27
327	0.3
328	0.3
329	0.3
330	0.32
331	0.33
332	0.35
333	0.36
334	0.33
335	0.29
336	0.27
337	0.24
338	0.21
339	0.17
340	0.14
341	0.11
342	0.11
343	0.11
344	0.11
345	0.12
346	0.14
347	0.18
348	0.18
349	0.17
350	0.17
351	0.17
352	0.18
353	0.2
354	0.19
355	0.16
356	0.14
357	0.14
358	0.14
359	0.14
360	0.12
361	0.09
362	0.09
363	0.08
364	0.09
365	0.09
366	0.09
367	0.16
368	0.17
369	0.19
370	0.17
371	0.17
372	0.18
373	0.18
374	0.2
375	0.13
376	0.16
377	0.13
378	0.13
379	0.12
380	0.11
381	0.11
382	0.11
383	0.11
384	0.07
385	0.08
386	0.08
387	0.09
388	0.08
389	0.07
390	0.07
391	0.08
392	0.08
393	0.09
394	0.09
395	0.09
396	0.12
397	0.14
398	0.13
399	0.13
400	0.16
401	0.2
402	0.26
403	0.28
404	0.28
405	0.25
406	0.26
407	0.29
408	0.26
409	0.21
410	0.17
411	0.14
412	0.15
413	0.17
414	0.21
415	0.22
416	0.22
417	0.27
418	0.29
419	0.3
420	0.29
421	0.3
422	0.27
423	0.25
424	0.24
425	0.2
426	0.22
427	0.23
428	0.28
429	0.32
430	0.33
431	0.36
432	0.44
433	0.51
434	0.54
435	0.56
436	0.54
437	0.54
438	0.56
439	0.59
440	0.6
441	0.56
442	0.54
443	0.55
444	0.58
445	0.56
446	0.54
447	0.54
448	0.5
449	0.55
450	0.53
451	0.51
452	0.5
453	0.48
454	0.48
455	0.47
456	0.44
457	0.36
458	0.32
459	0.31
460	0.25
461	0.23
462	0.19
463	0.11
464	0.1
465	0.1
466	0.1
467	0.11
468	0.13
469	0.15
470	0.16
471	0.15
472	0.14
473	0.14
474	0.13
475	0.11
476	0.12
477	0.11
478	0.12
479	0.12
480	0.13
481	0.15
482	0.16
483	0.2
484	0.27
485	0.34
486	0.38
487	0.44
488	0.43
489	0.44
490	0.5
491	0.53
492	0.52
493	0.49
494	0.54
495	0.56
496	0.58
497	0.59
498	0.53
499	0.47
500	0.4
501	0.35
502	0.29
503	0.25
504	0.24
505	0.22
506	0.25
507	0.23
508	0.21
509	0.2
510	0.16
511	0.13
512	0.12
513	0.12
514	0.13
515	0.13
516	0.13
517	0.14
518	0.14
519	0.13
520	0.13
521	0.12
522	0.07
523	0.07
524	0.06
525	0.04
526	0.04
527	0.05
528	0.06
529	0.07
530	0.12
531	0.12
532	0.12
533	0.13
534	0.13
535	0.13
536	0.13
537	0.14
538	0.12
539	0.14
540	0.16
541	0.15
542	0.15
543	0.14
544	0.13
545	0.12
546	0.1
547	0.09
548	0.07
549	0.06
550	0.06
551	0.06
552	0.06
553	0.05
554	0.04
555	0.04
556	0.04
557	0.04
558	0.03
559	0.03
560	0.04
561	0.04
562	0.06
563	0.07
564	0.07
565	0.08
566	0.09
567	0.1
568	0.11
569	0.11
570	0.12
571	0.12
572	0.13
573	0.16
574	0.15
575	0.16
576	0.16
577	0.18
578	0.18
579	0.18
580	0.2
581	0.17
582	0.17
583	0.21
584	0.22
585	0.2
586	0.2
587	0.2
588	0.2
589	0.23
590	0.24
591	0.21
592	0.21
593	0.26
594	0.29
595	0.34
596	0.33
597	0.32
598	0.35
599	0.35
600	0.34
601	0.32
602	0.32
603	0.28
604	0.26
605	0.25
606	0.22
607	0.22
608	0.21
609	0.18
610	0.15
611	0.19
612	0.22
613	0.22
614	0.27
615	0.31
616	0.37
617	0.44
618	0.5
619	0.55
620	0.62
621	0.71
622	0.75
623	0.8
624	0.82
625	0.85
626	0.87
627	0.87
628	0.87
629	0.88
630	0.88
631	0.86
632	0.87
633	0.81
634	0.81
635	0.77
636	0.72
637	0.63
638	0.57
639	0.52
640	0.48
641	0.47
642	0.39
643	0.38
644	0.37
645	0.35
646	0.36
647	0.37
648	0.33
649	0.34
650	0.36
651	0.37
652	0.37
653	0.42
654	0.42
655	0.42
656	0.45
657	0.41
658	0.39
659	0.32
660	0.26
661	0.23
662	0.19
663	0.13
664	0.11
665	0.12
666	0.13
667	0.13
668	0.15
669	0.14
670	0.14
671	0.14
672	0.13
673	0.11
674	0.09
675	0.09
676	0.07
677	0.07
678	0.06
679	0.06
680	0.07
681	0.08
682	0.11
683	0.11
684	0.11
685	0.12
686	0.14
687	0.19
688	0.25
689	0.29
690	0.35
691	0.44
692	0.49
693	0.55
694	0.62
695	0.66
696	0.68
697	0.74
698	0.7
699	0.69
700	0.65
701	0.58
702	0.5
703	0.41
704	0.3
705	0.21
706	0.16
707	0.08
708	0.07
709	0.06
710	0.06
711	0.07
712	0.09
713	0.09
714	0.09
715	0.11
716	0.12
717	0.12
718	0.14
719	0.16
720	0.16
721	0.17
722	0.18
723	0.17
724	0.19
725	0.2
726	0.2
727	0.18
728	0.17
729	0.18
730	0.2
731	0.22
732	0.23
733	0.24
734	0.27
735	0.31
736	0.38
737	0.43
738	0.48
739	0.56
740	0.64
741	0.71
742	0.77
743	0.83
744	0.86
745	0.91
746	0.93
747	0.93
748	0.93
749	0.94
750	0.93
751	0.87
752	0.86
753	0.84
754	0.82
755	0.8
756	0.8
757	0.74
758	0.75
759	0.82
760	0.76
761	0.75
762	0.72
763	0.7
764	0.61
765	0.61
766	0.58
767	0.52
768	0.5
769	0.43
770	0.37
771	0.3
772	0.32
773	0.27
774	0.2
775	0.18
776	0.17
777	0.18
778	0.2
779	0.25
780	0.22
781	0.23
782	0.27
783	0.31
784	0.31
785	0.34
786	0.32
787	0.28
788	0.28
789	0.3
790	0.3
791	0.26
792	0.3
793	0.31
794	0.38
795	0.46
796	0.53
797	0.55
798	0.54
799	0.56
800	0.59
801	0.62
802	0.57
803	0.57
804	0.56
805	0.62
806	0.68
807	0.69
808	0.65
809	0.65
810	0.7
811	0.71
812	0.73
813	0.72
814	0.73
815	0.77
816	0.84
817	0.87
818	0.89
819	0.89
820	0.86
821	0.85
822	0.85
823	0.84

Q59MD2

3D AlphaFold-predicted Structure Viewer