Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PU39

Protein Details
Accession A0A1D8PU39    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
261-292NTEPTKQSTKQSNKVKKPRKLSKKSSTKALAKHydrophilic
NLS Segment(s)
PositionSequence
273-288NKVKKPRKLSKKSSTK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021264  YDR124W-like  
IPR047092  YDR124W-like_helical  
KEGG cal:CAALFM_CR09930WA  -  
Pfam View protein in Pfam  
PF11001  DUF2841  
Amino Acid Sequences MGYPEELEKIKELLEEASATCNFKYMLITQGISPTTDVAFTYSKHFTHEEVNDYRVVFGRSFTSIRPVLNRTYTLKLSRSSDNWDAITRQLHDLFNSLNQGVCKEIAKLWIRILAPNKQKHFPYSKKDVVPNWWPRDVVHTEPDHLRKEDRIKVLINVVTNKNFKFRDVDTKSIKTKVEHTEAIIHEIIYIAYLAGLFYFGHDRDNETYDILSSNDRKLLEQDEIEFEVSDFRYFGNEGISQSKIKDEYLNENLFRLKGGNTEPTKQSTKQSNKVKKPRKLSKKSSTKALAKVKLDLLDPQENFDLRITPEAQPRSQSPLQLPQSTPKDPAPEFEFPFQDTASKSDLMMHTQGDEMSLDPTFDPNTGYHIVPNTAPDYMQNYFNMNNDNYVDPAAAYIPDPSETSQYISQGVKKKWEDKLDSLFEEDFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.18
5 0.19
6 0.2
7 0.18
8 0.19
9 0.17
10 0.17
11 0.19
12 0.16
13 0.2
14 0.21
15 0.22
16 0.21
17 0.26
18 0.26
19 0.23
20 0.22
21 0.17
22 0.14
23 0.14
24 0.13
25 0.12
26 0.13
27 0.13
28 0.19
29 0.21
30 0.21
31 0.25
32 0.26
33 0.24
34 0.31
35 0.34
36 0.36
37 0.35
38 0.37
39 0.35
40 0.34
41 0.33
42 0.28
43 0.26
44 0.18
45 0.17
46 0.17
47 0.19
48 0.2
49 0.19
50 0.24
51 0.24
52 0.26
53 0.3
54 0.31
55 0.32
56 0.35
57 0.38
58 0.36
59 0.39
60 0.41
61 0.41
62 0.41
63 0.4
64 0.4
65 0.41
66 0.39
67 0.41
68 0.42
69 0.4
70 0.38
71 0.36
72 0.33
73 0.31
74 0.32
75 0.27
76 0.25
77 0.26
78 0.25
79 0.23
80 0.24
81 0.22
82 0.2
83 0.21
84 0.17
85 0.16
86 0.15
87 0.15
88 0.15
89 0.15
90 0.13
91 0.12
92 0.13
93 0.19
94 0.22
95 0.23
96 0.23
97 0.27
98 0.27
99 0.3
100 0.34
101 0.35
102 0.4
103 0.46
104 0.49
105 0.49
106 0.5
107 0.52
108 0.57
109 0.57
110 0.57
111 0.58
112 0.62
113 0.62
114 0.66
115 0.63
116 0.6
117 0.61
118 0.63
119 0.59
120 0.53
121 0.48
122 0.42
123 0.46
124 0.43
125 0.36
126 0.32
127 0.28
128 0.29
129 0.34
130 0.38
131 0.35
132 0.32
133 0.3
134 0.3
135 0.36
136 0.4
137 0.38
138 0.37
139 0.35
140 0.35
141 0.38
142 0.35
143 0.3
144 0.27
145 0.26
146 0.28
147 0.29
148 0.28
149 0.3
150 0.28
151 0.27
152 0.27
153 0.26
154 0.33
155 0.35
156 0.42
157 0.42
158 0.47
159 0.48
160 0.49
161 0.48
162 0.38
163 0.39
164 0.38
165 0.37
166 0.32
167 0.31
168 0.33
169 0.32
170 0.34
171 0.27
172 0.21
173 0.16
174 0.15
175 0.13
176 0.07
177 0.07
178 0.03
179 0.03
180 0.03
181 0.03
182 0.02
183 0.03
184 0.03
185 0.03
186 0.05
187 0.05
188 0.07
189 0.07
190 0.1
191 0.11
192 0.14
193 0.14
194 0.12
195 0.12
196 0.11
197 0.12
198 0.1
199 0.11
200 0.1
201 0.1
202 0.12
203 0.13
204 0.12
205 0.13
206 0.15
207 0.14
208 0.13
209 0.13
210 0.13
211 0.13
212 0.13
213 0.12
214 0.09
215 0.09
216 0.09
217 0.08
218 0.07
219 0.06
220 0.06
221 0.07
222 0.07
223 0.08
224 0.09
225 0.1
226 0.12
227 0.14
228 0.13
229 0.13
230 0.15
231 0.13
232 0.13
233 0.15
234 0.14
235 0.2
236 0.26
237 0.29
238 0.27
239 0.27
240 0.27
241 0.24
242 0.22
243 0.16
244 0.1
245 0.1
246 0.12
247 0.2
248 0.21
249 0.25
250 0.27
251 0.3
252 0.34
253 0.33
254 0.37
255 0.39
256 0.45
257 0.5
258 0.59
259 0.65
260 0.71
261 0.81
262 0.85
263 0.83
264 0.85
265 0.87
266 0.88
267 0.88
268 0.88
269 0.88
270 0.89
271 0.84
272 0.82
273 0.8
274 0.75
275 0.74
276 0.72
277 0.68
278 0.58
279 0.58
280 0.51
281 0.44
282 0.38
283 0.32
284 0.29
285 0.29
286 0.27
287 0.27
288 0.26
289 0.24
290 0.25
291 0.22
292 0.19
293 0.12
294 0.16
295 0.16
296 0.18
297 0.25
298 0.28
299 0.28
300 0.29
301 0.3
302 0.35
303 0.34
304 0.34
305 0.31
306 0.37
307 0.41
308 0.43
309 0.42
310 0.43
311 0.47
312 0.46
313 0.46
314 0.38
315 0.4
316 0.35
317 0.38
318 0.36
319 0.36
320 0.37
321 0.37
322 0.36
323 0.31
324 0.32
325 0.27
326 0.23
327 0.19
328 0.18
329 0.18
330 0.17
331 0.16
332 0.2
333 0.21
334 0.22
335 0.22
336 0.2
337 0.18
338 0.18
339 0.18
340 0.13
341 0.12
342 0.09
343 0.09
344 0.09
345 0.08
346 0.08
347 0.1
348 0.1
349 0.1
350 0.11
351 0.1
352 0.15
353 0.17
354 0.17
355 0.18
356 0.19
357 0.2
358 0.19
359 0.22
360 0.19
361 0.17
362 0.16
363 0.16
364 0.19
365 0.19
366 0.22
367 0.2
368 0.21
369 0.22
370 0.25
371 0.28
372 0.23
373 0.24
374 0.24
375 0.24
376 0.22
377 0.21
378 0.19
379 0.13
380 0.13
381 0.11
382 0.1
383 0.09
384 0.09
385 0.1
386 0.11
387 0.12
388 0.13
389 0.16
390 0.16
391 0.2
392 0.21
393 0.21
394 0.24
395 0.26
396 0.32
397 0.37
398 0.4
399 0.45
400 0.5
401 0.56
402 0.6
403 0.67
404 0.67
405 0.66
406 0.72
407 0.69
408 0.64
409 0.6