Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8B0T0

Protein Details
Accession S8B0T0   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
141-168ELPAVKSKEGNRKPKKAKKIKLSFDQDEHydrophilic
NLS Segment(s)
PositionSequence
146-161KSKEGNRKPKKAKKIK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPKNAKLAYEAKEPAFLQKLRGHYGDNAGRLERPAARPRRLKNQDEEDDDAPVYVDETNNEVISKADYDALVNGGPNGKTDETSATSETAKISEIGAQSPAKSTVSRQQNNLLEIGGSKKRKQAKLVGDHEQEQPALEQAELPAVKSKEGNRKPKKAKKIKLSFDQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.34
4 0.32
5 0.33
6 0.37
7 0.37
8 0.38
9 0.35
10 0.31
11 0.39
12 0.39
13 0.37
14 0.34
15 0.31
16 0.3
17 0.28
18 0.29
19 0.25
20 0.26
21 0.33
22 0.39
23 0.46
24 0.54
25 0.59
26 0.67
27 0.71
28 0.71
29 0.7
30 0.71
31 0.69
32 0.67
33 0.65
34 0.55
35 0.48
36 0.42
37 0.33
38 0.23
39 0.16
40 0.11
41 0.07
42 0.06
43 0.05
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.09
65 0.08
66 0.08
67 0.09
68 0.11
69 0.12
70 0.13
71 0.14
72 0.12
73 0.12
74 0.12
75 0.12
76 0.1
77 0.08
78 0.07
79 0.07
80 0.08
81 0.08
82 0.08
83 0.11
84 0.11
85 0.11
86 0.11
87 0.12
88 0.11
89 0.1
90 0.12
91 0.18
92 0.28
93 0.3
94 0.32
95 0.39
96 0.41
97 0.42
98 0.4
99 0.32
100 0.22
101 0.2
102 0.22
103 0.21
104 0.21
105 0.21
106 0.27
107 0.36
108 0.4
109 0.44
110 0.49
111 0.52
112 0.59
113 0.63
114 0.66
115 0.61
116 0.59
117 0.57
118 0.49
119 0.39
120 0.29
121 0.24
122 0.16
123 0.14
124 0.11
125 0.09
126 0.08
127 0.14
128 0.13
129 0.13
130 0.19
131 0.18
132 0.2
133 0.23
134 0.3
135 0.35
136 0.45
137 0.55
138 0.59
139 0.7
140 0.8
141 0.86
142 0.91
143 0.91
144 0.92
145 0.92
146 0.92
147 0.91
148 0.9