Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8A0M8

Protein Details
Accession S8A0M8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-45FFFTIPPKKHKKPDTPCTCKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
Amino Acid Sequences MLLGKRLSSSLFNARDMKGQENRVFFFTIPPKKHKKPDTPCTCKEGQRQHESRHCSFASIKALNVSLFSNHHTVEQIFDFINDCLQIPRPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.39
4 0.4
5 0.37
6 0.41
7 0.42
8 0.42
9 0.42
10 0.39
11 0.38
12 0.31
13 0.31
14 0.33
15 0.37
16 0.37
17 0.43
18 0.5
19 0.56
20 0.65
21 0.67
22 0.69
23 0.71
24 0.78
25 0.82
26 0.81
27 0.77
28 0.73
29 0.68
30 0.63
31 0.6
32 0.58
33 0.54
34 0.55
35 0.57
36 0.58
37 0.61
38 0.62
39 0.56
40 0.52
41 0.45
42 0.38
43 0.35
44 0.33
45 0.34
46 0.28
47 0.26
48 0.22
49 0.23
50 0.2
51 0.2
52 0.16
53 0.11
54 0.11
55 0.13
56 0.14
57 0.14
58 0.15
59 0.15
60 0.15
61 0.16
62 0.16
63 0.15
64 0.13
65 0.13
66 0.14
67 0.13
68 0.14
69 0.11
70 0.11
71 0.11