Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S8AU04

Protein Details
Accession S8AU04   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-65TSTRYGKRSCRAHRNWREPDIHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 14, cyto 9, mito 3
Family & Domain DBs
Amino Acid Sequences MDAHLTVVLAHGGTGLRIMHGWSSIITWASDAVFMIPTRPCPLDTSTRYGKRSCRAHRNWREPDIYIRRVSLSDVRLPSRAEVAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.07
8 0.08
9 0.07
10 0.08
11 0.08
12 0.09
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.05
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.11
26 0.11
27 0.12
28 0.13
29 0.16
30 0.22
31 0.24
32 0.29
33 0.34
34 0.39
35 0.4
36 0.41
37 0.43
38 0.44
39 0.51
40 0.54
41 0.58
42 0.62
43 0.71
44 0.79
45 0.84
46 0.83
47 0.8
48 0.74
49 0.65
50 0.66
51 0.63
52 0.57
53 0.48
54 0.41
55 0.36
56 0.34
57 0.35
58 0.31
59 0.26
60 0.29
61 0.32
62 0.34
63 0.35
64 0.36
65 0.34
66 0.33