Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5AKL3

Protein Details
Accession T5AKL3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKNKKAHNVKFKVRCQRYHydrophilic
NLS Segment(s)
PositionSequence
22-32SARIKKNKKAH
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKEVADIKKFIEICRRKDASSARIKKNKKAHNVKFKVRCQRYLYTLVLKDTEKAEKLKQSLPPNLQITDLSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.66
12 0.69
13 0.71
14 0.75
15 0.74
16 0.73
17 0.75
18 0.75
19 0.78
20 0.82
21 0.82
22 0.82
23 0.81
24 0.81
25 0.73
26 0.7
27 0.64
28 0.6
29 0.56
30 0.52
31 0.47
32 0.42
33 0.4
34 0.35
35 0.32
36 0.28
37 0.25
38 0.22
39 0.23
40 0.19
41 0.21
42 0.24
43 0.27
44 0.31
45 0.34
46 0.4
47 0.44
48 0.5
49 0.51
50 0.55
51 0.53
52 0.5
53 0.47
54 0.41
55 0.39