Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A7K1

Protein Details
Accession T5A7K1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-37ATGRSVYLSHKKRRDEKQKNSPTRNETWHydrophilic
41-63SAITWRGRRKTRKAPNPDNGQPSHydrophilic
NLS Segment(s)
PositionSequence
20-28KKRRDEKQK
44-55TWRGRRKTRKAP
Subcellular Location(s) mito 11, extr 10, nucl 6
Family & Domain DBs
Amino Acid Sequences MASLLIALIATGRSVYLSHKKRRDEKQKNSPTRNETWAKSSAITWRGRRKTRKAPNPDNGQPSKRNTSHTVEDDAPRLSQQSTLADKDAYAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.11
3 0.21
4 0.3
5 0.39
6 0.47
7 0.55
8 0.64
9 0.74
10 0.8
11 0.81
12 0.84
13 0.85
14 0.89
15 0.91
16 0.89
17 0.86
18 0.81
19 0.74
20 0.71
21 0.64
22 0.55
23 0.48
24 0.44
25 0.37
26 0.32
27 0.28
28 0.26
29 0.27
30 0.3
31 0.32
32 0.38
33 0.45
34 0.52
35 0.59
36 0.62
37 0.67
38 0.73
39 0.77
40 0.78
41 0.81
42 0.82
43 0.83
44 0.8
45 0.78
46 0.72
47 0.67
48 0.62
49 0.57
50 0.57
51 0.5
52 0.49
53 0.46
54 0.47
55 0.48
56 0.47
57 0.46
58 0.41
59 0.41
60 0.38
61 0.34
62 0.28
63 0.22
64 0.21
65 0.16
66 0.15
67 0.15
68 0.19
69 0.22
70 0.24
71 0.26
72 0.24
73 0.24