Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5ANT9

Protein Details
Accession T5ANT9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-37TEEFRRVKRKQAKPAAVPGGKHydrophilic
NLS Segment(s)
PositionSequence
24-26KRK
Subcellular Location(s) mito 19, cyto 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
Pfam View protein in Pfam  
PF01423  LSM  
Amino Acid Sequences MSNKQGKMHMNLVLADTEEFRRVKRKQAKPAAVPGGKPTFQVIESDEKRTLGLIIVRGAQIVSVSAESPPPADPSARLGKSAPGGIVSTLTAGPGVAKPAGRGAPPPSLAGPAAGVGGGALPPGFPNFPGSSVFGRGSAPPGYPGTWPPPAFQPNFPGPSGFGAPGAPPGGPPGAPPGGAPGFNPPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.18
4 0.15
5 0.17
6 0.17
7 0.18
8 0.26
9 0.27
10 0.37
11 0.46
12 0.54
13 0.61
14 0.71
15 0.79
16 0.76
17 0.83
18 0.82
19 0.74
20 0.65
21 0.6
22 0.55
23 0.46
24 0.41
25 0.33
26 0.25
27 0.22
28 0.23
29 0.19
30 0.23
31 0.25
32 0.28
33 0.28
34 0.26
35 0.25
36 0.24
37 0.22
38 0.14
39 0.14
40 0.11
41 0.12
42 0.13
43 0.13
44 0.12
45 0.12
46 0.1
47 0.07
48 0.06
49 0.05
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.14
62 0.21
63 0.21
64 0.21
65 0.2
66 0.21
67 0.22
68 0.22
69 0.17
70 0.1
71 0.1
72 0.09
73 0.09
74 0.07
75 0.06
76 0.05
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.08
87 0.09
88 0.09
89 0.1
90 0.12
91 0.15
92 0.16
93 0.17
94 0.15
95 0.15
96 0.15
97 0.13
98 0.1
99 0.07
100 0.06
101 0.05
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.02
108 0.02
109 0.03
110 0.04
111 0.04
112 0.05
113 0.08
114 0.09
115 0.11
116 0.12
117 0.15
118 0.16
119 0.18
120 0.18
121 0.16
122 0.16
123 0.15
124 0.17
125 0.15
126 0.14
127 0.14
128 0.15
129 0.15
130 0.16
131 0.18
132 0.2
133 0.26
134 0.26
135 0.25
136 0.31
137 0.35
138 0.37
139 0.37
140 0.38
141 0.37
142 0.4
143 0.39
144 0.33
145 0.28
146 0.29
147 0.29
148 0.23
149 0.17
150 0.14
151 0.14
152 0.15
153 0.15
154 0.11
155 0.09
156 0.11
157 0.12
158 0.12
159 0.12
160 0.16
161 0.16
162 0.16
163 0.16
164 0.2
165 0.21
166 0.21
167 0.21
168 0.24
169 0.31