Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A9N4

Protein Details
Accession T5A9N4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
59-84AAPPPRLPLSSKKKKQKSVQEVVTTLHydrophilic
443-463SLPQTVRKGKADKKGKAGKKGBasic
NLS Segment(s)
PositionSequence
449-463RKGKADKKGKAGKKG
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001865  Ribosomal_S2  
IPR005706  Ribosomal_S2_bac/mit/plastid  
IPR018130  Ribosomal_S2_CS  
IPR023591  Ribosomal_S2_flav_dom_sf  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00318  Ribosomal_S2  
PROSITE View protein in PROSITE  
PS00962  RIBOSOMAL_S2_1  
CDD cd01425  RPS2  
Amino Acid Sequences MTLRNVALRYGRRALAAPLPPTAIRRLSTEVKTGNAKVESTPNASPPASEQAWATHQTAAPPPRLPLSSKKKKQKSVQEVVTTLSSEAVREHRGASWARPHKIGDEVVSPAQQYAGFQRIKKNTRNLGTEVKKRYIPSELLVNPPRPEDVTLELLLASQTHLGHITSAWNPANSRYIFGVREGIHIISLETTAAHLRRAARVVEEVAYRGGLIVFVGTGKGQMEIVTKAAKRAGACHLFTKWTPGAITNRDVILKNRMKKVVDHLDKTLDNFDDYNGTTRPLIPDLVICLNPVENYTVLYECGLKNIPTIGVIDTNADPSWVTYTIPANDDSLRAMAVVAGVLGRAGEKGKIRRLLDAEMGNVPWETSPELQKHMGQKTKEAISKKKEVMGKIQSQVEGFTEEEKQMLRTHYNEEAPDFDEAKMMDVLGETAAGEKAKAETDSLPQTVRKGKADKKGKAGKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.41
4 0.36
5 0.33
6 0.34
7 0.33
8 0.34
9 0.35
10 0.31
11 0.26
12 0.28
13 0.33
14 0.37
15 0.39
16 0.44
17 0.41
18 0.41
19 0.45
20 0.42
21 0.42
22 0.36
23 0.34
24 0.3
25 0.35
26 0.34
27 0.34
28 0.34
29 0.31
30 0.33
31 0.32
32 0.3
33 0.27
34 0.3
35 0.25
36 0.24
37 0.22
38 0.22
39 0.26
40 0.29
41 0.27
42 0.23
43 0.23
44 0.26
45 0.32
46 0.33
47 0.33
48 0.31
49 0.31
50 0.32
51 0.33
52 0.34
53 0.37
54 0.44
55 0.51
56 0.6
57 0.69
58 0.75
59 0.82
60 0.88
61 0.89
62 0.89
63 0.88
64 0.87
65 0.82
66 0.73
67 0.66
68 0.57
69 0.47
70 0.36
71 0.27
72 0.18
73 0.12
74 0.13
75 0.14
76 0.16
77 0.16
78 0.17
79 0.16
80 0.21
81 0.23
82 0.25
83 0.32
84 0.38
85 0.4
86 0.41
87 0.41
88 0.38
89 0.41
90 0.37
91 0.3
92 0.24
93 0.24
94 0.23
95 0.23
96 0.21
97 0.16
98 0.15
99 0.13
100 0.11
101 0.11
102 0.17
103 0.2
104 0.22
105 0.3
106 0.39
107 0.46
108 0.52
109 0.58
110 0.59
111 0.62
112 0.65
113 0.62
114 0.63
115 0.64
116 0.65
117 0.61
118 0.56
119 0.53
120 0.49
121 0.47
122 0.42
123 0.35
124 0.29
125 0.32
126 0.3
127 0.35
128 0.38
129 0.39
130 0.35
131 0.33
132 0.32
133 0.25
134 0.24
135 0.19
136 0.18
137 0.18
138 0.18
139 0.17
140 0.16
141 0.15
142 0.13
143 0.11
144 0.08
145 0.06
146 0.06
147 0.06
148 0.07
149 0.06
150 0.07
151 0.07
152 0.1
153 0.09
154 0.14
155 0.14
156 0.14
157 0.15
158 0.16
159 0.22
160 0.19
161 0.2
162 0.17
163 0.19
164 0.19
165 0.19
166 0.23
167 0.17
168 0.18
169 0.18
170 0.16
171 0.14
172 0.13
173 0.12
174 0.07
175 0.07
176 0.05
177 0.04
178 0.05
179 0.06
180 0.07
181 0.07
182 0.09
183 0.1
184 0.12
185 0.14
186 0.14
187 0.13
188 0.14
189 0.15
190 0.14
191 0.14
192 0.12
193 0.1
194 0.1
195 0.08
196 0.07
197 0.06
198 0.04
199 0.03
200 0.03
201 0.02
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.04
208 0.04
209 0.05
210 0.06
211 0.07
212 0.08
213 0.11
214 0.11
215 0.11
216 0.12
217 0.13
218 0.12
219 0.14
220 0.19
221 0.2
222 0.21
223 0.23
224 0.22
225 0.23
226 0.23
227 0.25
228 0.19
229 0.15
230 0.15
231 0.16
232 0.19
233 0.2
234 0.22
235 0.18
236 0.18
237 0.19
238 0.2
239 0.18
240 0.24
241 0.27
242 0.31
243 0.34
244 0.37
245 0.36
246 0.37
247 0.44
248 0.45
249 0.45
250 0.42
251 0.39
252 0.4
253 0.39
254 0.38
255 0.32
256 0.22
257 0.17
258 0.15
259 0.13
260 0.11
261 0.11
262 0.13
263 0.11
264 0.12
265 0.11
266 0.12
267 0.13
268 0.12
269 0.12
270 0.09
271 0.1
272 0.11
273 0.13
274 0.12
275 0.11
276 0.1
277 0.1
278 0.1
279 0.1
280 0.09
281 0.07
282 0.07
283 0.08
284 0.09
285 0.08
286 0.09
287 0.1
288 0.09
289 0.11
290 0.11
291 0.1
292 0.1
293 0.11
294 0.11
295 0.09
296 0.1
297 0.09
298 0.09
299 0.09
300 0.1
301 0.1
302 0.11
303 0.1
304 0.1
305 0.09
306 0.08
307 0.1
308 0.09
309 0.09
310 0.09
311 0.12
312 0.14
313 0.16
314 0.16
315 0.15
316 0.15
317 0.15
318 0.14
319 0.12
320 0.1
321 0.08
322 0.08
323 0.06
324 0.05
325 0.05
326 0.04
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.04
333 0.05
334 0.08
335 0.13
336 0.19
337 0.26
338 0.34
339 0.34
340 0.39
341 0.41
342 0.42
343 0.42
344 0.38
345 0.33
346 0.27
347 0.27
348 0.22
349 0.19
350 0.15
351 0.1
352 0.1
353 0.1
354 0.11
355 0.17
356 0.18
357 0.22
358 0.24
359 0.29
360 0.35
361 0.41
362 0.45
363 0.41
364 0.44
365 0.46
366 0.51
367 0.52
368 0.52
369 0.52
370 0.53
371 0.61
372 0.59
373 0.59
374 0.56
375 0.54
376 0.57
377 0.57
378 0.56
379 0.53
380 0.53
381 0.48
382 0.44
383 0.42
384 0.33
385 0.27
386 0.2
387 0.17
388 0.16
389 0.14
390 0.15
391 0.15
392 0.15
393 0.16
394 0.2
395 0.21
396 0.22
397 0.27
398 0.31
399 0.35
400 0.35
401 0.33
402 0.32
403 0.3
404 0.31
405 0.27
406 0.21
407 0.2
408 0.18
409 0.19
410 0.16
411 0.14
412 0.11
413 0.1
414 0.1
415 0.08
416 0.08
417 0.05
418 0.06
419 0.08
420 0.07
421 0.07
422 0.08
423 0.09
424 0.11
425 0.12
426 0.13
427 0.14
428 0.2
429 0.26
430 0.27
431 0.29
432 0.28
433 0.34
434 0.39
435 0.42
436 0.44
437 0.48
438 0.54
439 0.61
440 0.7
441 0.72
442 0.75
443 0.8