Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A8X8

Protein Details
Accession T5A8X8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
343-376ALKAYPPPPNLKKEKKVKNKGTRHPGKANNEELPHydrophilic
NLS Segment(s)
PositionSequence
352-369NLKKEKKVKNKGTRHPGK
Subcellular Location(s) cyto 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002307  Tyr-tRNA-ligase  
IPR023617  Tyr-tRNA-ligase_arc/euk-type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0004831  F:tyrosine-tRNA ligase activity  
GO:0006437  P:tyrosyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences MATTTAAERLALIRENLAEILNPEIIEKIIEEGRNPKIYWGTATTGRPHCGYFVPAIKIAQLLAAGCDVTVLLADIHGFLDNLKAPIELVAHRVDYYRFVITAILEAVGVSTEKLRFVQGSDYQKSAEYVMDVYKLSSLISEHDAKRAGAEVVKQTDNAPLSGLLYPILQVLDEQYLDVDAQFGGLDQRKLFIAAKDWLPKLGYRERAHILNPMVPGLHGGKMSSSDQASKIDLLDAPEAVAKKINKAVAAPKVIEENGLLAFVEYVLLPAAALRGKREFSVDRERDGLEPLVYSDIAEMHRDYQNDVLNPQTLKPAVAKAVSNLLAPIQTAYQGSKEWQDIALKAYPPPPNLKKEKKVKNKGTRHPGKANNEELPIREAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.15
5 0.13
6 0.12
7 0.14
8 0.13
9 0.13
10 0.12
11 0.12
12 0.11
13 0.11
14 0.1
15 0.11
16 0.14
17 0.14
18 0.16
19 0.22
20 0.28
21 0.32
22 0.32
23 0.32
24 0.31
25 0.32
26 0.34
27 0.32
28 0.3
29 0.31
30 0.35
31 0.4
32 0.4
33 0.42
34 0.39
35 0.36
36 0.33
37 0.29
38 0.28
39 0.26
40 0.27
41 0.28
42 0.28
43 0.28
44 0.26
45 0.25
46 0.22
47 0.17
48 0.12
49 0.09
50 0.07
51 0.08
52 0.07
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.07
68 0.09
69 0.1
70 0.1
71 0.09
72 0.09
73 0.1
74 0.12
75 0.11
76 0.12
77 0.13
78 0.13
79 0.13
80 0.15
81 0.14
82 0.15
83 0.17
84 0.15
85 0.13
86 0.13
87 0.14
88 0.12
89 0.13
90 0.1
91 0.08
92 0.06
93 0.06
94 0.06
95 0.05
96 0.05
97 0.04
98 0.06
99 0.06
100 0.07
101 0.08
102 0.09
103 0.09
104 0.1
105 0.15
106 0.21
107 0.28
108 0.29
109 0.3
110 0.3
111 0.3
112 0.29
113 0.24
114 0.17
115 0.1
116 0.09
117 0.09
118 0.1
119 0.1
120 0.09
121 0.09
122 0.09
123 0.08
124 0.07
125 0.07
126 0.07
127 0.1
128 0.16
129 0.16
130 0.18
131 0.2
132 0.19
133 0.19
134 0.18
135 0.16
136 0.11
137 0.13
138 0.14
139 0.17
140 0.17
141 0.17
142 0.17
143 0.2
144 0.19
145 0.17
146 0.13
147 0.1
148 0.11
149 0.11
150 0.1
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.05
164 0.05
165 0.05
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.05
172 0.07
173 0.08
174 0.07
175 0.08
176 0.08
177 0.1
178 0.11
179 0.09
180 0.11
181 0.13
182 0.16
183 0.2
184 0.2
185 0.19
186 0.19
187 0.19
188 0.21
189 0.25
190 0.3
191 0.27
192 0.31
193 0.33
194 0.33
195 0.33
196 0.33
197 0.28
198 0.23
199 0.22
200 0.18
201 0.15
202 0.14
203 0.14
204 0.11
205 0.11
206 0.08
207 0.08
208 0.08
209 0.1
210 0.11
211 0.12
212 0.11
213 0.11
214 0.12
215 0.14
216 0.14
217 0.13
218 0.12
219 0.11
220 0.11
221 0.11
222 0.11
223 0.09
224 0.09
225 0.1
226 0.1
227 0.09
228 0.13
229 0.11
230 0.13
231 0.17
232 0.18
233 0.17
234 0.18
235 0.24
236 0.26
237 0.28
238 0.26
239 0.24
240 0.24
241 0.24
242 0.22
243 0.16
244 0.11
245 0.09
246 0.08
247 0.07
248 0.05
249 0.05
250 0.05
251 0.05
252 0.03
253 0.04
254 0.03
255 0.03
256 0.03
257 0.03
258 0.05
259 0.06
260 0.07
261 0.09
262 0.12
263 0.13
264 0.14
265 0.19
266 0.2
267 0.25
268 0.36
269 0.36
270 0.35
271 0.37
272 0.37
273 0.34
274 0.34
275 0.28
276 0.17
277 0.16
278 0.14
279 0.13
280 0.12
281 0.11
282 0.08
283 0.09
284 0.09
285 0.11
286 0.11
287 0.13
288 0.16
289 0.16
290 0.18
291 0.2
292 0.24
293 0.24
294 0.24
295 0.23
296 0.24
297 0.24
298 0.23
299 0.23
300 0.19
301 0.19
302 0.2
303 0.2
304 0.2
305 0.21
306 0.21
307 0.18
308 0.24
309 0.23
310 0.22
311 0.19
312 0.17
313 0.15
314 0.14
315 0.14
316 0.08
317 0.09
318 0.1
319 0.11
320 0.11
321 0.12
322 0.14
323 0.17
324 0.18
325 0.18
326 0.2
327 0.22
328 0.21
329 0.24
330 0.28
331 0.25
332 0.26
333 0.31
334 0.33
335 0.34
336 0.43
337 0.46
338 0.5
339 0.6
340 0.67
341 0.71
342 0.77
343 0.84
344 0.86
345 0.9
346 0.92
347 0.92
348 0.93
349 0.93
350 0.94
351 0.94
352 0.91
353 0.9
354 0.88
355 0.87
356 0.85
357 0.81
358 0.75
359 0.7
360 0.63
361 0.55