Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AF53

Protein Details
Accession T5AF53    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
277-296FTNARPPSRSPPSRSPPSRSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0016798  F:hydrolase activity, acting on glycosyl bonds  
GO:0045493  P:xylan catabolic process  
Amino Acid Sequences MDGTIPVSIDSGSRPGSRPRASYARRAAIGASYPFRGIYYFVSIREFWPLFVGRLLPLSLISLVVYLVLFTFAFLPQYAFLAIFHGWGAWVNAVVLTLGEGLVIIQGLFEGFFVDECRVDVFDATMIKLGFQHLVSPHRLLFVDAPNAVKMLGKPTSPAIYQPWSIIQIVELIVFLPLNLVPYVGTPAFIIITGTRIGKLSHYRWFQLRGLSKNEQKREIRGLTWDYVWFGTVAMFLELIPILSFFFLLTTTAGSALWAARMEEERRRSRTVVESHFTNARPPSRSPPSRSPPSRSSPPPPYSDNAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.36
4 0.41
5 0.42
6 0.46
7 0.54
8 0.56
9 0.63
10 0.64
11 0.62
12 0.58
13 0.56
14 0.49
15 0.41
16 0.42
17 0.36
18 0.29
19 0.23
20 0.23
21 0.22
22 0.21
23 0.19
24 0.16
25 0.14
26 0.19
27 0.2
28 0.21
29 0.24
30 0.25
31 0.25
32 0.31
33 0.28
34 0.2
35 0.23
36 0.23
37 0.2
38 0.21
39 0.21
40 0.14
41 0.15
42 0.15
43 0.11
44 0.1
45 0.1
46 0.09
47 0.08
48 0.08
49 0.06
50 0.06
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.06
59 0.05
60 0.06
61 0.07
62 0.08
63 0.07
64 0.08
65 0.08
66 0.07
67 0.07
68 0.09
69 0.09
70 0.08
71 0.08
72 0.07
73 0.06
74 0.07
75 0.07
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.03
100 0.04
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.07
107 0.07
108 0.06
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.07
119 0.09
120 0.1
121 0.13
122 0.15
123 0.15
124 0.15
125 0.15
126 0.15
127 0.14
128 0.14
129 0.13
130 0.14
131 0.13
132 0.14
133 0.12
134 0.12
135 0.11
136 0.1
137 0.08
138 0.09
139 0.1
140 0.09
141 0.1
142 0.11
143 0.13
144 0.13
145 0.14
146 0.13
147 0.14
148 0.15
149 0.15
150 0.14
151 0.14
152 0.14
153 0.12
154 0.1
155 0.08
156 0.08
157 0.07
158 0.06
159 0.04
160 0.04
161 0.04
162 0.04
163 0.03
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.08
171 0.07
172 0.07
173 0.06
174 0.07
175 0.07
176 0.06
177 0.07
178 0.04
179 0.06
180 0.07
181 0.07
182 0.07
183 0.08
184 0.08
185 0.11
186 0.17
187 0.19
188 0.26
189 0.28
190 0.3
191 0.33
192 0.37
193 0.36
194 0.37
195 0.41
196 0.37
197 0.42
198 0.46
199 0.51
200 0.54
201 0.57
202 0.57
203 0.53
204 0.54
205 0.55
206 0.5
207 0.44
208 0.41
209 0.4
210 0.34
211 0.33
212 0.29
213 0.22
214 0.2
215 0.19
216 0.14
217 0.1
218 0.08
219 0.07
220 0.07
221 0.06
222 0.06
223 0.05
224 0.06
225 0.06
226 0.06
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.05
236 0.05
237 0.06
238 0.06
239 0.07
240 0.07
241 0.06
242 0.07
243 0.07
244 0.08
245 0.07
246 0.07
247 0.09
248 0.13
249 0.17
250 0.24
251 0.33
252 0.4
253 0.44
254 0.48
255 0.48
256 0.49
257 0.54
258 0.55
259 0.54
260 0.51
261 0.48
262 0.48
263 0.52
264 0.47
265 0.44
266 0.42
267 0.39
268 0.39
269 0.41
270 0.46
271 0.52
272 0.6
273 0.62
274 0.66
275 0.7
276 0.77
277 0.8
278 0.79
279 0.76
280 0.76
281 0.78
282 0.75
283 0.75
284 0.74
285 0.72
286 0.7
287 0.66