Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T4ZZH6

Protein Details
Accession T4ZZH6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
25-45TWTPSSWRSRPIKQSPQYPDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR002480  DAHP_synth_2  
Gene Ontology GO:0003849  F:3-deoxy-7-phosphoheptulonate synthase activity  
GO:0008652  P:amino acid biosynthetic process  
GO:0009073  P:aromatic amino acid family biosynthetic process  
GO:0009423  P:chorismate biosynthetic process  
Pfam View protein in Pfam  
PF01474  DAHP_synth_2  
Amino Acid Sequences MATDPHSSQQRGQGGAAHHHHHQETWTPSSWRSRPIKQSPQYPDAEKLSRAVAELSRMPPLVHPSEILTLKAQLRDVAHGKAFLLQGGDCAELFDYCEQGAIESKIKLLLQMSVVLIWGTNKPVVRIGRMAGQYAKPRSSPTEMVQGKEIPSFRGDILNGYRVDERDIDPSPGVGFGGGSNSSSGSSSPAQRARHYGESRPEANKREYYDTSAHFVWIGDRTRQLDHAHVEFFRGIANPIGIKVGPTTPSADLLTLLRTLNPSREPGKITLITRYGAGRVAELLPQHIRAVEDSEYTRCVVWQCDPMHGNTLSTPTGIKTRRFNDIYRELQESLRIHKEQGSYLGGVHLELTGDAVTECLGGSEGLAEDDLSTNYTSFCDPRLNEKQALELAFLIADHYSQEQKLSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.44
4 0.39
5 0.37
6 0.4
7 0.4
8 0.36
9 0.36
10 0.35
11 0.35
12 0.37
13 0.39
14 0.36
15 0.39
16 0.48
17 0.49
18 0.5
19 0.53
20 0.56
21 0.62
22 0.7
23 0.77
24 0.75
25 0.81
26 0.8
27 0.8
28 0.76
29 0.69
30 0.64
31 0.6
32 0.56
33 0.47
34 0.4
35 0.35
36 0.3
37 0.27
38 0.24
39 0.19
40 0.19
41 0.23
42 0.23
43 0.24
44 0.23
45 0.23
46 0.23
47 0.27
48 0.26
49 0.23
50 0.22
51 0.21
52 0.27
53 0.27
54 0.26
55 0.21
56 0.23
57 0.25
58 0.26
59 0.24
60 0.21
61 0.21
62 0.26
63 0.28
64 0.27
65 0.25
66 0.24
67 0.24
68 0.24
69 0.23
70 0.18
71 0.16
72 0.12
73 0.12
74 0.13
75 0.13
76 0.09
77 0.09
78 0.09
79 0.08
80 0.09
81 0.09
82 0.08
83 0.07
84 0.08
85 0.07
86 0.08
87 0.1
88 0.11
89 0.14
90 0.13
91 0.14
92 0.15
93 0.15
94 0.15
95 0.13
96 0.13
97 0.11
98 0.13
99 0.12
100 0.11
101 0.11
102 0.09
103 0.09
104 0.08
105 0.08
106 0.08
107 0.1
108 0.1
109 0.11
110 0.17
111 0.18
112 0.2
113 0.21
114 0.2
115 0.24
116 0.25
117 0.26
118 0.23
119 0.26
120 0.3
121 0.32
122 0.32
123 0.27
124 0.28
125 0.3
126 0.33
127 0.32
128 0.28
129 0.35
130 0.34
131 0.34
132 0.34
133 0.32
134 0.28
135 0.27
136 0.25
137 0.16
138 0.15
139 0.16
140 0.14
141 0.15
142 0.14
143 0.14
144 0.16
145 0.19
146 0.19
147 0.19
148 0.2
149 0.18
150 0.19
151 0.18
152 0.17
153 0.16
154 0.17
155 0.17
156 0.15
157 0.15
158 0.13
159 0.12
160 0.1
161 0.06
162 0.05
163 0.04
164 0.05
165 0.05
166 0.05
167 0.05
168 0.06
169 0.06
170 0.06
171 0.06
172 0.08
173 0.09
174 0.11
175 0.16
176 0.21
177 0.23
178 0.24
179 0.28
180 0.29
181 0.36
182 0.37
183 0.37
184 0.38
185 0.41
186 0.43
187 0.43
188 0.43
189 0.38
190 0.39
191 0.38
192 0.34
193 0.35
194 0.33
195 0.33
196 0.32
197 0.29
198 0.29
199 0.26
200 0.23
201 0.18
202 0.17
203 0.13
204 0.14
205 0.14
206 0.12
207 0.14
208 0.16
209 0.17
210 0.19
211 0.19
212 0.19
213 0.2
214 0.2
215 0.2
216 0.18
217 0.18
218 0.16
219 0.14
220 0.12
221 0.09
222 0.08
223 0.07
224 0.08
225 0.07
226 0.07
227 0.08
228 0.07
229 0.07
230 0.07
231 0.08
232 0.09
233 0.1
234 0.12
235 0.11
236 0.13
237 0.13
238 0.12
239 0.12
240 0.11
241 0.11
242 0.1
243 0.1
244 0.08
245 0.1
246 0.11
247 0.13
248 0.15
249 0.17
250 0.19
251 0.21
252 0.24
253 0.24
254 0.28
255 0.29
256 0.28
257 0.29
258 0.29
259 0.26
260 0.25
261 0.23
262 0.18
263 0.17
264 0.16
265 0.12
266 0.11
267 0.12
268 0.12
269 0.12
270 0.14
271 0.12
272 0.13
273 0.13
274 0.12
275 0.12
276 0.11
277 0.14
278 0.12
279 0.13
280 0.14
281 0.16
282 0.16
283 0.16
284 0.15
285 0.13
286 0.14
287 0.14
288 0.15
289 0.21
290 0.21
291 0.27
292 0.28
293 0.28
294 0.32
295 0.3
296 0.27
297 0.21
298 0.23
299 0.17
300 0.16
301 0.16
302 0.12
303 0.2
304 0.23
305 0.27
306 0.32
307 0.35
308 0.44
309 0.47
310 0.48
311 0.49
312 0.54
313 0.55
314 0.5
315 0.52
316 0.44
317 0.41
318 0.45
319 0.38
320 0.35
321 0.36
322 0.33
323 0.3
324 0.33
325 0.35
326 0.31
327 0.33
328 0.3
329 0.24
330 0.23
331 0.23
332 0.18
333 0.16
334 0.15
335 0.1
336 0.07
337 0.07
338 0.07
339 0.05
340 0.05
341 0.05
342 0.05
343 0.05
344 0.05
345 0.05
346 0.04
347 0.05
348 0.04
349 0.04
350 0.05
351 0.05
352 0.06
353 0.06
354 0.06
355 0.06
356 0.07
357 0.08
358 0.08
359 0.09
360 0.09
361 0.09
362 0.11
363 0.12
364 0.12
365 0.14
366 0.2
367 0.21
368 0.31
369 0.4
370 0.45
371 0.48
372 0.47
373 0.5
374 0.47
375 0.46
376 0.38
377 0.29
378 0.23
379 0.18
380 0.17
381 0.13
382 0.09
383 0.08
384 0.07
385 0.1
386 0.13
387 0.13
388 0.15