Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5AFL5

Protein Details
Accession T5AFL5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-36SAEARSHHHHHHRDIKRNAVSBasic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005556  SUN  
Pfam View protein in Pfam  
PF03856  SUN  
Amino Acid Sequences MKGPTKYTLVAVLAASAEARSHHHHHHRDIKRNAVSAVQHPSATTEATPEGKTIYMYGETMMSEYDVKKCLKDKTCAIVTESVGETQTSQRQQQPTTTTKTETPDAVLKPTQPAGQQELQQTEAPSNSNKSVNMTAEFPNDSISCSEMPVQYGAIRLPWLHDSSSWSSLLRVKGYPKAKELTVEGTCETCEPGCMCSYACPVGYGETQWPKAQGSNKESVGGLECNPQGRLSLTNPSYRTLCRRSAADIKITNRLGKRVSSCRTAYPGTEAMVIPAVAEPGMTIPLWIPVNTDYTSPTGGKTSAEYYINHAGVAPEVGCVWKSETLSDRAGDLAPVIMGGSVDFDTKNIFLSIHQNIKYKSEAPKFNITIEGDVIGKPCWYKGNEYPGPKPPGVVLGCTATVKAGGSATFVFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.09
4 0.08
5 0.07
6 0.11
7 0.16
8 0.21
9 0.31
10 0.41
11 0.49
12 0.58
13 0.68
14 0.74
15 0.78
16 0.81
17 0.81
18 0.77
19 0.72
20 0.64
21 0.59
22 0.53
23 0.48
24 0.48
25 0.4
26 0.34
27 0.31
28 0.32
29 0.27
30 0.25
31 0.19
32 0.14
33 0.16
34 0.18
35 0.19
36 0.17
37 0.17
38 0.16
39 0.16
40 0.14
41 0.14
42 0.12
43 0.12
44 0.12
45 0.12
46 0.11
47 0.11
48 0.1
49 0.09
50 0.1
51 0.11
52 0.13
53 0.17
54 0.18
55 0.21
56 0.26
57 0.35
58 0.39
59 0.44
60 0.48
61 0.51
62 0.56
63 0.54
64 0.52
65 0.47
66 0.41
67 0.38
68 0.32
69 0.25
70 0.2
71 0.18
72 0.16
73 0.15
74 0.21
75 0.21
76 0.24
77 0.3
78 0.34
79 0.36
80 0.4
81 0.44
82 0.43
83 0.47
84 0.46
85 0.43
86 0.42
87 0.44
88 0.4
89 0.34
90 0.31
91 0.3
92 0.28
93 0.3
94 0.27
95 0.25
96 0.25
97 0.26
98 0.25
99 0.21
100 0.23
101 0.25
102 0.27
103 0.29
104 0.31
105 0.31
106 0.31
107 0.3
108 0.28
109 0.23
110 0.2
111 0.18
112 0.16
113 0.17
114 0.18
115 0.18
116 0.18
117 0.2
118 0.23
119 0.23
120 0.22
121 0.22
122 0.21
123 0.22
124 0.22
125 0.18
126 0.17
127 0.15
128 0.15
129 0.12
130 0.12
131 0.1
132 0.1
133 0.12
134 0.11
135 0.11
136 0.11
137 0.11
138 0.1
139 0.1
140 0.1
141 0.08
142 0.08
143 0.07
144 0.09
145 0.1
146 0.11
147 0.11
148 0.11
149 0.16
150 0.19
151 0.21
152 0.2
153 0.18
154 0.18
155 0.21
156 0.23
157 0.2
158 0.18
159 0.19
160 0.25
161 0.31
162 0.32
163 0.31
164 0.32
165 0.3
166 0.3
167 0.28
168 0.27
169 0.22
170 0.21
171 0.18
172 0.16
173 0.16
174 0.14
175 0.13
176 0.07
177 0.07
178 0.06
179 0.07
180 0.07
181 0.08
182 0.08
183 0.08
184 0.1
185 0.1
186 0.1
187 0.09
188 0.09
189 0.1
190 0.1
191 0.1
192 0.12
193 0.14
194 0.15
195 0.15
196 0.16
197 0.14
198 0.17
199 0.22
200 0.25
201 0.27
202 0.3
203 0.3
204 0.3
205 0.3
206 0.27
207 0.23
208 0.18
209 0.14
210 0.13
211 0.13
212 0.13
213 0.13
214 0.13
215 0.11
216 0.11
217 0.13
218 0.11
219 0.18
220 0.19
221 0.24
222 0.25
223 0.26
224 0.27
225 0.26
226 0.31
227 0.29
228 0.31
229 0.28
230 0.28
231 0.32
232 0.39
233 0.39
234 0.39
235 0.39
236 0.37
237 0.43
238 0.42
239 0.41
240 0.34
241 0.35
242 0.3
243 0.28
244 0.32
245 0.33
246 0.36
247 0.38
248 0.38
249 0.38
250 0.41
251 0.38
252 0.33
253 0.29
254 0.27
255 0.21
256 0.22
257 0.19
258 0.15
259 0.14
260 0.13
261 0.09
262 0.08
263 0.07
264 0.04
265 0.04
266 0.04
267 0.04
268 0.05
269 0.04
270 0.04
271 0.04
272 0.08
273 0.09
274 0.09
275 0.1
276 0.1
277 0.14
278 0.14
279 0.15
280 0.13
281 0.14
282 0.16
283 0.15
284 0.15
285 0.13
286 0.13
287 0.13
288 0.13
289 0.14
290 0.15
291 0.17
292 0.17
293 0.21
294 0.27
295 0.26
296 0.24
297 0.22
298 0.19
299 0.17
300 0.17
301 0.12
302 0.06
303 0.06
304 0.06
305 0.06
306 0.07
307 0.09
308 0.11
309 0.12
310 0.15
311 0.18
312 0.22
313 0.24
314 0.23
315 0.21
316 0.2
317 0.19
318 0.16
319 0.13
320 0.09
321 0.07
322 0.06
323 0.06
324 0.04
325 0.04
326 0.04
327 0.05
328 0.05
329 0.06
330 0.07
331 0.07
332 0.09
333 0.09
334 0.1
335 0.09
336 0.09
337 0.1
338 0.17
339 0.23
340 0.29
341 0.33
342 0.37
343 0.38
344 0.41
345 0.43
346 0.41
347 0.45
348 0.46
349 0.5
350 0.5
351 0.59
352 0.57
353 0.55
354 0.56
355 0.47
356 0.4
357 0.34
358 0.29
359 0.2
360 0.19
361 0.19
362 0.13
363 0.13
364 0.12
365 0.13
366 0.18
367 0.19
368 0.25
369 0.32
370 0.42
371 0.48
372 0.54
373 0.59
374 0.62
375 0.67
376 0.6
377 0.53
378 0.44
379 0.45
380 0.39
381 0.35
382 0.28
383 0.24
384 0.26
385 0.25
386 0.24
387 0.16
388 0.15
389 0.14
390 0.12
391 0.1
392 0.09
393 0.11