Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AHV2

Protein Details
Accession T5AHV2   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-102PPATPKRKAAPRRAPKSSKKKLKRDEESTGSBasic
NLS Segment(s)
PositionSequence
76-96PKRKAAPRRAPKSSKKKLKRD
106-114IKKRAKKEK
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MSKTQDSTEQIKFLVSCIHNATGGKPNFQAVADQLGIVTKAAAQKRYERLLKAHGVGAPTKSPNGTEESEVPPATPKRKAAPRRAPKSSKKKLKRDEESTGSDEDIKKRAKKEKAESPVASDLSDAPASADESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.21
4 0.23
5 0.24
6 0.24
7 0.25
8 0.27
9 0.28
10 0.28
11 0.28
12 0.25
13 0.24
14 0.23
15 0.23
16 0.21
17 0.13
18 0.16
19 0.14
20 0.13
21 0.12
22 0.11
23 0.11
24 0.1
25 0.08
26 0.06
27 0.1
28 0.13
29 0.16
30 0.18
31 0.24
32 0.29
33 0.36
34 0.38
35 0.35
36 0.36
37 0.38
38 0.39
39 0.34
40 0.31
41 0.26
42 0.24
43 0.23
44 0.21
45 0.17
46 0.15
47 0.14
48 0.12
49 0.11
50 0.11
51 0.14
52 0.14
53 0.13
54 0.15
55 0.17
56 0.19
57 0.18
58 0.17
59 0.17
60 0.19
61 0.2
62 0.2
63 0.2
64 0.25
65 0.35
66 0.43
67 0.5
68 0.59
69 0.66
70 0.72
71 0.79
72 0.81
73 0.82
74 0.85
75 0.85
76 0.85
77 0.85
78 0.87
79 0.88
80 0.9
81 0.89
82 0.85
83 0.83
84 0.78
85 0.73
86 0.65
87 0.56
88 0.46
89 0.4
90 0.35
91 0.29
92 0.29
93 0.3
94 0.32
95 0.38
96 0.47
97 0.52
98 0.6
99 0.66
100 0.71
101 0.73
102 0.77
103 0.72
104 0.69
105 0.66
106 0.57
107 0.47
108 0.38
109 0.3
110 0.24
111 0.23
112 0.16
113 0.11
114 0.12