Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AJ22

Protein Details
Accession T5AJ22    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-85DKEEGKDKKGKDKKGKDKKGKDKKGKDRRKGKNBasic
NLS Segment(s)
PositionSequence
55-85EEGKDKKGKDKKGKDKKGKDKKGKDRRKGKN
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MGFEKQSELWVFEEPHRGRGRAQIPRPGERIHGFRFYVQAAGAPEIANDTSKDKEEGKDKKGKDKKGKDKKGKDKKGKDRRKGKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.36
5 0.34
6 0.4
7 0.46
8 0.46
9 0.5
10 0.5
11 0.52
12 0.57
13 0.58
14 0.51
15 0.47
16 0.41
17 0.41
18 0.36
19 0.35
20 0.31
21 0.28
22 0.29
23 0.24
24 0.21
25 0.16
26 0.14
27 0.1
28 0.1
29 0.1
30 0.08
31 0.07
32 0.07
33 0.08
34 0.06
35 0.06
36 0.08
37 0.09
38 0.1
39 0.12
40 0.13
41 0.16
42 0.25
43 0.31
44 0.36
45 0.43
46 0.44
47 0.53
48 0.6
49 0.67
50 0.69
51 0.73
52 0.78
53 0.81
54 0.9
55 0.9
56 0.93
57 0.94
58 0.95
59 0.95
60 0.94
61 0.94
62 0.94
63 0.95
64 0.95
65 0.94