Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5A188

Protein Details
Accession T5A188    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
208-237HKDSHKHKDSHGHDHHRRKSHHHHSHRHKHBasic
NLS Segment(s)
PositionSequence
206-237HKHKDSHKHKDSHGHDHHRRKSHHHHSHRHKH
Subcellular Location(s) extr 12, cyto 5.5, mito 5, cyto_nucl 4.5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MGTCISMLAGKSSRYRLEPYVALQNSFALSILDHYFVVSIRGSAAQDRGALLSQDPVLTPNLTPALTPALTPVLTPVLTPVLTPDLTPVLTPNLTPNLTPVLTPNLTPVLAALLVIGTDIVTMTPDLKVPLMPRRGKKLICDAPRGQGEEIEGENGEEQPAPDGASGPGDGNEGGGDGDGDGTQQPPQQPEAGPSQGGGGHHHASHKHKDSHKHKDSHGHDHHRRKSHHHHSHRHKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.35
4 0.38
5 0.38
6 0.37
7 0.43
8 0.4
9 0.38
10 0.33
11 0.3
12 0.25
13 0.23
14 0.19
15 0.09
16 0.08
17 0.09
18 0.11
19 0.11
20 0.1
21 0.1
22 0.1
23 0.1
24 0.12
25 0.09
26 0.08
27 0.07
28 0.09
29 0.1
30 0.11
31 0.12
32 0.12
33 0.12
34 0.13
35 0.13
36 0.12
37 0.12
38 0.1
39 0.11
40 0.1
41 0.1
42 0.09
43 0.1
44 0.1
45 0.11
46 0.1
47 0.11
48 0.12
49 0.12
50 0.11
51 0.11
52 0.14
53 0.13
54 0.13
55 0.11
56 0.12
57 0.11
58 0.11
59 0.11
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.09
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.13
82 0.13
83 0.13
84 0.14
85 0.14
86 0.14
87 0.13
88 0.14
89 0.14
90 0.14
91 0.14
92 0.12
93 0.12
94 0.12
95 0.11
96 0.06
97 0.06
98 0.06
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.03
112 0.04
113 0.05
114 0.05
115 0.06
116 0.08
117 0.15
118 0.22
119 0.28
120 0.3
121 0.38
122 0.43
123 0.43
124 0.44
125 0.48
126 0.49
127 0.48
128 0.52
129 0.46
130 0.46
131 0.48
132 0.47
133 0.36
134 0.28
135 0.24
136 0.19
137 0.18
138 0.13
139 0.1
140 0.08
141 0.08
142 0.08
143 0.07
144 0.06
145 0.05
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.07
152 0.08
153 0.08
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.06
160 0.05
161 0.05
162 0.04
163 0.04
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.07
171 0.09
172 0.11
173 0.13
174 0.15
175 0.17
176 0.18
177 0.2
178 0.25
179 0.24
180 0.22
181 0.21
182 0.2
183 0.19
184 0.19
185 0.19
186 0.18
187 0.18
188 0.19
189 0.22
190 0.26
191 0.31
192 0.4
193 0.45
194 0.49
195 0.54
196 0.63
197 0.7
198 0.76
199 0.8
200 0.77
201 0.74
202 0.76
203 0.76
204 0.77
205 0.77
206 0.77
207 0.77
208 0.81
209 0.85
210 0.84
211 0.81
212 0.8
213 0.81
214 0.81
215 0.82
216 0.82
217 0.84