Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AN80

Protein Details
Accession T5AN80   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
205-225QYWEPEPKKKKTKSEEGAKMAHydrophilic
NLS Segment(s)
PositionSequence
212-217KKKKTK
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 12.5
Family & Domain DBs
Amino Acid Sequences MSTKPCTLEAAVVADGPKTPEPADEEPPSPGSPSAPPPGGAIGAEVRQEAGRQASKVQGLVDMFDGMARRSTSPTAAVGKNDVAQEDSCPAEESEPSTTEHYAAETCSGSSARVLTDEVRDDGPQEDGLGTAVSSADWQDQLSQGSRGPQRIAYSLDLSRLDEIFPSTSAELEHGPASLTSDFFTTYKMEFVHDGTWAIDPWSAQYWEPEPKKKKTKSEEGAKMAPPPAPVNGLEAMRNVAEAEPVKLVKTELWDDVKRVILNNKALSKGSIIDIIFHQFRDSVSRAEVKNTIELFAEKKGPGRIKEWDLKPKYKIEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.16
5 0.14
6 0.14
7 0.16
8 0.22
9 0.27
10 0.33
11 0.33
12 0.34
13 0.34
14 0.37
15 0.35
16 0.3
17 0.25
18 0.21
19 0.21
20 0.24
21 0.27
22 0.26
23 0.26
24 0.25
25 0.26
26 0.24
27 0.2
28 0.17
29 0.13
30 0.13
31 0.13
32 0.12
33 0.12
34 0.11
35 0.12
36 0.12
37 0.15
38 0.17
39 0.17
40 0.19
41 0.23
42 0.24
43 0.25
44 0.23
45 0.21
46 0.18
47 0.18
48 0.17
49 0.13
50 0.11
51 0.11
52 0.11
53 0.08
54 0.11
55 0.11
56 0.11
57 0.14
58 0.15
59 0.15
60 0.17
61 0.2
62 0.23
63 0.23
64 0.23
65 0.23
66 0.22
67 0.24
68 0.22
69 0.19
70 0.15
71 0.14
72 0.14
73 0.14
74 0.13
75 0.11
76 0.12
77 0.11
78 0.11
79 0.11
80 0.12
81 0.13
82 0.13
83 0.15
84 0.15
85 0.15
86 0.15
87 0.15
88 0.13
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.09
95 0.09
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.08
102 0.08
103 0.1
104 0.11
105 0.12
106 0.13
107 0.12
108 0.12
109 0.12
110 0.12
111 0.1
112 0.09
113 0.07
114 0.06
115 0.06
116 0.05
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.06
128 0.08
129 0.09
130 0.09
131 0.09
132 0.14
133 0.17
134 0.17
135 0.17
136 0.18
137 0.18
138 0.19
139 0.21
140 0.17
141 0.18
142 0.17
143 0.18
144 0.17
145 0.16
146 0.15
147 0.12
148 0.11
149 0.08
150 0.08
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.06
162 0.06
163 0.06
164 0.08
165 0.07
166 0.07
167 0.06
168 0.07
169 0.08
170 0.08
171 0.09
172 0.08
173 0.09
174 0.1
175 0.1
176 0.1
177 0.1
178 0.12
179 0.11
180 0.1
181 0.11
182 0.1
183 0.1
184 0.09
185 0.09
186 0.08
187 0.07
188 0.08
189 0.1
190 0.1
191 0.1
192 0.12
193 0.14
194 0.22
195 0.27
196 0.35
197 0.4
198 0.48
199 0.58
200 0.63
201 0.7
202 0.7
203 0.76
204 0.77
205 0.8
206 0.81
207 0.76
208 0.74
209 0.65
210 0.6
211 0.5
212 0.42
213 0.33
214 0.25
215 0.2
216 0.18
217 0.17
218 0.17
219 0.17
220 0.16
221 0.15
222 0.15
223 0.15
224 0.12
225 0.12
226 0.1
227 0.08
228 0.1
229 0.1
230 0.11
231 0.12
232 0.12
233 0.13
234 0.13
235 0.13
236 0.12
237 0.15
238 0.17
239 0.19
240 0.25
241 0.26
242 0.27
243 0.29
244 0.31
245 0.28
246 0.28
247 0.28
248 0.28
249 0.33
250 0.38
251 0.38
252 0.37
253 0.37
254 0.35
255 0.32
256 0.27
257 0.22
258 0.21
259 0.17
260 0.17
261 0.18
262 0.22
263 0.21
264 0.19
265 0.19
266 0.15
267 0.16
268 0.2
269 0.21
270 0.18
271 0.21
272 0.28
273 0.28
274 0.32
275 0.35
276 0.31
277 0.35
278 0.33
279 0.31
280 0.26
281 0.27
282 0.25
283 0.25
284 0.27
285 0.21
286 0.25
287 0.32
288 0.37
289 0.39
290 0.41
291 0.45
292 0.49
293 0.58
294 0.63
295 0.65
296 0.67
297 0.71
298 0.71