Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AJQ4

Protein Details
Accession T5AJQ4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
95-118VNVLKSKEVKWERKRTGNRRFTVAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 9.833, nucl 8, pero 6, mito_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013784  Carb-bd-like_fold  
IPR002044  CBM_fam20  
IPR013783  Ig-like_fold  
Gene Ontology GO:2001070  F:starch binding  
GO:0000272  P:polysaccharide catabolic process  
Pfam View protein in Pfam  
PF00686  CBM_20  
PROSITE View protein in PROSITE  
PS51166  CBM20  
Amino Acid Sequences MPLQGSTGPESSGKNPPAHPADAGGCKEGSEVQVKFSVDVATSFGDVINITEPLAWEPAKAVEMSHVKYDDTAKRSLWEKTVPLRVGTTVEYKFVNVLKSKEVKWERKRTGNRRFTVACTDTDQKQVWQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.38
4 0.41
5 0.4
6 0.36
7 0.3
8 0.31
9 0.33
10 0.33
11 0.27
12 0.22
13 0.21
14 0.21
15 0.19
16 0.16
17 0.16
18 0.15
19 0.16
20 0.19
21 0.2
22 0.2
23 0.19
24 0.18
25 0.12
26 0.12
27 0.12
28 0.09
29 0.09
30 0.08
31 0.07
32 0.07
33 0.06
34 0.07
35 0.06
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.08
42 0.07
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.09
50 0.12
51 0.13
52 0.14
53 0.14
54 0.13
55 0.14
56 0.18
57 0.18
58 0.19
59 0.2
60 0.19
61 0.21
62 0.23
63 0.24
64 0.23
65 0.21
66 0.21
67 0.25
68 0.32
69 0.31
70 0.29
71 0.28
72 0.26
73 0.25
74 0.23
75 0.22
76 0.16
77 0.17
78 0.16
79 0.15
80 0.16
81 0.16
82 0.18
83 0.17
84 0.18
85 0.23
86 0.26
87 0.27
88 0.35
89 0.43
90 0.5
91 0.57
92 0.66
93 0.68
94 0.75
95 0.85
96 0.86
97 0.88
98 0.87
99 0.8
100 0.77
101 0.72
102 0.66
103 0.65
104 0.56
105 0.48
106 0.44
107 0.45
108 0.39
109 0.42
110 0.4