Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5AGY4

Protein Details
Accession T5AGY4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-49AASARFRIKKKQREQALEKSAKHydrophilic
NLS Segment(s)
PositionSequence
22-40KRRRNTAASARFRIKKKQR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MSADGQEVTFEEPTRVAAEEDKRRRNTAASARFRIKKKQREQALEKSAKEMTEKVNGLESRVSQLETENKWLKNLLVDKNEGSENITALWKEFTKHVSEKTRAASTKAAAAAKEDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.16
5 0.24
6 0.34
7 0.43
8 0.5
9 0.52
10 0.54
11 0.55
12 0.52
13 0.52
14 0.52
15 0.54
16 0.53
17 0.56
18 0.61
19 0.66
20 0.67
21 0.69
22 0.68
23 0.68
24 0.69
25 0.72
26 0.74
27 0.76
28 0.8
29 0.8
30 0.8
31 0.75
32 0.66
33 0.59
34 0.51
35 0.42
36 0.36
37 0.27
38 0.19
39 0.2
40 0.2
41 0.17
42 0.22
43 0.21
44 0.21
45 0.2
46 0.17
47 0.14
48 0.14
49 0.14
50 0.09
51 0.11
52 0.15
53 0.15
54 0.22
55 0.24
56 0.24
57 0.24
58 0.25
59 0.23
60 0.24
61 0.28
62 0.27
63 0.26
64 0.28
65 0.27
66 0.29
67 0.29
68 0.24
69 0.2
70 0.14
71 0.12
72 0.11
73 0.12
74 0.1
75 0.1
76 0.12
77 0.11
78 0.12
79 0.14
80 0.15
81 0.2
82 0.24
83 0.31
84 0.37
85 0.41
86 0.45
87 0.48
88 0.54
89 0.49
90 0.49
91 0.45
92 0.38
93 0.4
94 0.4
95 0.36
96 0.28