Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A904

Protein Details
Accession T5A904   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-126HKIAKLLKHKTPKKTPEKTPKNPPKNPSITKDKRPSSBasic
NLS Segment(s)
PositionSequence
93-124AKLLKHKTPKKTPEKTPKNPPKNPSITKDKRP
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MKLSFAAGLLAAFAGVAFAAPTDTVAQIQRRNVDVSQVFATPDLAQLDSQRLSHSVVELNGQTEKRDVSQQEGRPIKFKNLFKSAFDQFHKIAKLLKHKTPKKTPEKTPKNPPKNPSITKDKRPSSPTTLSKHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.03
4 0.02
5 0.02
6 0.03
7 0.03
8 0.04
9 0.05
10 0.06
11 0.08
12 0.11
13 0.16
14 0.19
15 0.23
16 0.25
17 0.26
18 0.28
19 0.27
20 0.3
21 0.26
22 0.26
23 0.25
24 0.22
25 0.2
26 0.17
27 0.18
28 0.12
29 0.13
30 0.1
31 0.09
32 0.09
33 0.09
34 0.12
35 0.12
36 0.12
37 0.11
38 0.11
39 0.12
40 0.12
41 0.12
42 0.11
43 0.1
44 0.11
45 0.11
46 0.11
47 0.12
48 0.11
49 0.11
50 0.1
51 0.1
52 0.1
53 0.13
54 0.12
55 0.16
56 0.23
57 0.25
58 0.33
59 0.37
60 0.37
61 0.37
62 0.38
63 0.39
64 0.4
65 0.41
66 0.39
67 0.42
68 0.43
69 0.41
70 0.45
71 0.43
72 0.42
73 0.4
74 0.38
75 0.31
76 0.34
77 0.33
78 0.28
79 0.28
80 0.27
81 0.36
82 0.38
83 0.44
84 0.5
85 0.57
86 0.66
87 0.72
88 0.77
89 0.78
90 0.81
91 0.84
92 0.85
93 0.88
94 0.88
95 0.89
96 0.9
97 0.9
98 0.89
99 0.83
100 0.82
101 0.81
102 0.79
103 0.75
104 0.75
105 0.73
106 0.75
107 0.8
108 0.76
109 0.74
110 0.73
111 0.72
112 0.69
113 0.71
114 0.68