Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AMD7

Protein Details
Accession T5AMD7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
143-164GYPWLGVGRRRLRRRPGASWQSHydrophilic
NLS Segment(s)
PositionSequence
152-157RRLRRR
Subcellular Location(s) mito 22, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032696  SQ_cyclase_C  
IPR032697  SQ_cyclase_N  
IPR018333  Squalene_cyclase  
IPR008930  Terpenoid_cyclase/PrenylTrfase  
Gene Ontology GO:0005811  C:lipid droplet  
GO:0016866  F:intramolecular transferase activity  
GO:0016740  F:transferase activity  
GO:0016104  P:triterpenoid biosynthetic process  
Pfam View protein in Pfam  
PF13243  SQHop_cyclase_C  
PF13249  SQHop_cyclase_N  
Amino Acid Sequences MLRAKAFIRRCGGVAKSRDFTRIFFAQFEVFPWDAVPQLPAEFILLPSAFFLNKYKQGSHRRASLGAHEAAIRYLANTQETEVWFGRWGCNYIYGTSNVFCGLQYFVDGNGQVLDMMASATGWLKQVQNPDGGWGEDLEFYDGYPWLGVGRRRLRRRPGASWQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.46
4 0.45
5 0.49
6 0.44
7 0.41
8 0.4
9 0.37
10 0.33
11 0.28
12 0.29
13 0.25
14 0.24
15 0.24
16 0.23
17 0.18
18 0.17
19 0.16
20 0.14
21 0.13
22 0.13
23 0.12
24 0.07
25 0.07
26 0.08
27 0.07
28 0.08
29 0.07
30 0.07
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.08
37 0.08
38 0.11
39 0.13
40 0.19
41 0.22
42 0.24
43 0.32
44 0.42
45 0.48
46 0.5
47 0.52
48 0.48
49 0.48
50 0.46
51 0.41
52 0.35
53 0.28
54 0.25
55 0.19
56 0.16
57 0.14
58 0.14
59 0.09
60 0.05
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.09
67 0.1
68 0.13
69 0.12
70 0.11
71 0.12
72 0.12
73 0.13
74 0.11
75 0.12
76 0.09
77 0.13
78 0.13
79 0.13
80 0.15
81 0.15
82 0.15
83 0.14
84 0.14
85 0.1
86 0.1
87 0.08
88 0.08
89 0.07
90 0.06
91 0.07
92 0.07
93 0.07
94 0.08
95 0.08
96 0.07
97 0.07
98 0.07
99 0.06
100 0.05
101 0.05
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.05
110 0.07
111 0.09
112 0.11
113 0.17
114 0.19
115 0.22
116 0.21
117 0.24
118 0.23
119 0.22
120 0.2
121 0.15
122 0.14
123 0.12
124 0.13
125 0.11
126 0.1
127 0.09
128 0.1
129 0.1
130 0.09
131 0.08
132 0.08
133 0.07
134 0.12
135 0.15
136 0.24
137 0.34
138 0.44
139 0.54
140 0.63
141 0.72
142 0.78
143 0.83
144 0.82