FuNGI

T5AKC9

Protein Details

Accession

T5AKC9

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
187-209	ITDNAQHRKRRRIWDKSLRAKAL	Hydrophilic

NLS Segment(s)

Position	Sequence
195-197	KRR

Subcellular Location(s)

plas 21, E.R. 3, extr 1, pero 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR001128 Cyt_P450 IPR002401 Cyt_P450_E_grp-I IPR036396 Cyt_P450_sf
Gene Ontology	GO:0016020 C:membrane GO:0020037 F:heme binding GO:0005506 F:iron ion binding GO:0004497 F:monooxygenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Pfam	View protein in Pfam PF00067 p450

Amino Acid Sequences

MLELFLRSDARFMAAVGSFCAVAAVVGLLLHLLYFIHGFRVLQVKNMIVSHLVGLGLVLAETTSTFGPWKGLVAYVAISSAYFAALFLSIVTYRLFFHPLRHFPGPFPAKITKLHTPWIARHGKLHWEYAKLHQRYGEFVRVGPNEISIVNPDAYAKVHGPQSPCSKRDTGIFDSLHYNGQHRLVSITDNAQHRKRRRIWDKSLRAKALQGYELGTRRVMHDWLTRLDEHVGAPIDTTLYAKLIALDNMGHIGFSTDFGTVREGRQDRMMHLLEITFQNAAMMGQLSWPQALIMDLPKFGMQKEFERLAVRMVDDRIKNYPDDKHDMLSFLLADLMSENPKGLTNLNAVYADCQSILSGSVHTTSCVLGLVFYYLARDAHLRQRVYDEIAPLHGRTIPGEFTASDLGSIELLDSITNEAMRMHSPAPLNGPRSVPPEGIEVDGTFLPGGINVFTPSHVYNISDKYYKQPGEFIPDRWTTRQDLVIDTRAFQPFGFGHYDCVAKRLAKNVLRLAVAYTLWKYDFEFAPGEDGATFRNNEVFRVILKLGSLKCVFTKRSRA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.16
2	0.16
3	0.16
4	0.16
5	0.13
6	0.13
7	0.13
8	0.08
9	0.06
10	0.06
11	0.04
12	0.04
13	0.04
14	0.04
15	0.03
16	0.03
17	0.03
18	0.03
19	0.03
20	0.04
21	0.05
22	0.06
23	0.08
24	0.09
25	0.09
26	0.12
27	0.2
28	0.2
29	0.23
30	0.26
31	0.25
32	0.27
33	0.27
34	0.25
35	0.18
36	0.19
37	0.15
38	0.13
39	0.12
40	0.09
41	0.08
42	0.07
43	0.06
44	0.05
45	0.04
46	0.03
47	0.03
48	0.03
49	0.05
50	0.05
51	0.06
52	0.07
53	0.07
54	0.09
55	0.09
56	0.11
57	0.1
58	0.11
59	0.11
60	0.11
61	0.12
62	0.1
63	0.1
64	0.09
65	0.07
66	0.07
67	0.07
68	0.06
69	0.05
70	0.05
71	0.05
72	0.05
73	0.05
74	0.05
75	0.06
76	0.06
77	0.07
78	0.08
79	0.08
80	0.1
81	0.11
82	0.16
83	0.15
84	0.22
85	0.31
86	0.36
87	0.42
88	0.46
89	0.45
90	0.42
91	0.52
92	0.49
93	0.41
94	0.42
95	0.38
96	0.36
97	0.39
98	0.44
99	0.41
100	0.39
101	0.44
102	0.43
103	0.43
104	0.44
105	0.49
106	0.5
107	0.43
108	0.44
109	0.42
110	0.45
111	0.44
112	0.48
113	0.42
114	0.39
115	0.41
116	0.46
117	0.54
118	0.46
119	0.45
120	0.4
121	0.38
122	0.39
123	0.42
124	0.39
125	0.29
126	0.29
127	0.35
128	0.32
129	0.34
130	0.29
131	0.24
132	0.18
133	0.17
134	0.17
135	0.12
136	0.13
137	0.1
138	0.1
139	0.1
140	0.1
141	0.11
142	0.12
143	0.11
144	0.12
145	0.16
146	0.19
147	0.21
148	0.26
149	0.36
150	0.41
151	0.41
152	0.42
153	0.4
154	0.39
155	0.42
156	0.43
157	0.37
158	0.37
159	0.37
160	0.34
161	0.34
162	0.34
163	0.32
164	0.26
165	0.22
166	0.17
167	0.19
168	0.18
169	0.16
170	0.16
171	0.13
172	0.14
173	0.14
174	0.15
175	0.17
176	0.22
177	0.27
178	0.32
179	0.4
180	0.44
181	0.53
182	0.58
183	0.64
184	0.7
185	0.75
186	0.8
187	0.82
188	0.87
189	0.88
190	0.87
191	0.79
192	0.7
193	0.62
194	0.54
195	0.46
196	0.36
197	0.27
198	0.2
199	0.21
200	0.22
201	0.21
202	0.18
203	0.15
204	0.16
205	0.17
206	0.16
207	0.15
208	0.17
209	0.19
210	0.21
211	0.23
212	0.21
213	0.21
214	0.21
215	0.19
216	0.15
217	0.14
218	0.12
219	0.09
220	0.09
221	0.08
222	0.07
223	0.07
224	0.07
225	0.05
226	0.05
227	0.05
228	0.05
229	0.06
230	0.06
231	0.06
232	0.06
233	0.06
234	0.06
235	0.07
236	0.06
237	0.05
238	0.04
239	0.05
240	0.05
241	0.05
242	0.06
243	0.06
244	0.06
245	0.07
246	0.09
247	0.09
248	0.1
249	0.16
250	0.16
251	0.16
252	0.21
253	0.22
254	0.2
255	0.25
256	0.26
257	0.19
258	0.18
259	0.17
260	0.13
261	0.13
262	0.13
263	0.07
264	0.06
265	0.06
266	0.05
267	0.05
268	0.04
269	0.04
270	0.03
271	0.04
272	0.05
273	0.06
274	0.05
275	0.05
276	0.05
277	0.05
278	0.05
279	0.05
280	0.06
281	0.07
282	0.07
283	0.07
284	0.09
285	0.09
286	0.09
287	0.12
288	0.11
289	0.13
290	0.17
291	0.18
292	0.19
293	0.2
294	0.2
295	0.18
296	0.17
297	0.16
298	0.13
299	0.14
300	0.17
301	0.16
302	0.18
303	0.19
304	0.19
305	0.2
306	0.21
307	0.24
308	0.23
309	0.29
310	0.28
311	0.27
312	0.26
313	0.26
314	0.23
315	0.19
316	0.15
317	0.08
318	0.08
319	0.06
320	0.05
321	0.05
322	0.05
323	0.06
324	0.06
325	0.06
326	0.06
327	0.06
328	0.07
329	0.07
330	0.08
331	0.1
332	0.11
333	0.12
334	0.12
335	0.11
336	0.12
337	0.12
338	0.1
339	0.08
340	0.08
341	0.06
342	0.06
343	0.07
344	0.06
345	0.06
346	0.06
347	0.08
348	0.09
349	0.09
350	0.09
351	0.08
352	0.08
353	0.08
354	0.07
355	0.05
356	0.05
357	0.06
358	0.05
359	0.05
360	0.05
361	0.06
362	0.06
363	0.07
364	0.08
365	0.1
366	0.18
367	0.25
368	0.25
369	0.25
370	0.29
371	0.3
372	0.33
373	0.32
374	0.25
375	0.2
376	0.22
377	0.23
378	0.19
379	0.18
380	0.15
381	0.13
382	0.12
383	0.13
384	0.11
385	0.11
386	0.12
387	0.11
388	0.11
389	0.12
390	0.11
391	0.1
392	0.09
393	0.09
394	0.07
395	0.07
396	0.06
397	0.04
398	0.05
399	0.04
400	0.04
401	0.05
402	0.06
403	0.06
404	0.06
405	0.06
406	0.07
407	0.08
408	0.11
409	0.1
410	0.14
411	0.15
412	0.16
413	0.23
414	0.27
415	0.29
416	0.29
417	0.31
418	0.3
419	0.33
420	0.34
421	0.28
422	0.24
423	0.24
424	0.23
425	0.22
426	0.2
427	0.15
428	0.14
429	0.14
430	0.13
431	0.09
432	0.08
433	0.07
434	0.06
435	0.07
436	0.05
437	0.06
438	0.07
439	0.08
440	0.08
441	0.11
442	0.11
443	0.13
444	0.13
445	0.15
446	0.17
447	0.21
448	0.24
449	0.25
450	0.25
451	0.29
452	0.37
453	0.38
454	0.34
455	0.36
456	0.34
457	0.41
458	0.43
459	0.39
460	0.38
461	0.41
462	0.44
463	0.42
464	0.43
465	0.38
466	0.38
467	0.41
468	0.35
469	0.34
470	0.35
471	0.4
472	0.37
473	0.35
474	0.37
475	0.33
476	0.32
477	0.26
478	0.26
479	0.18
480	0.21
481	0.24
482	0.19
483	0.21
484	0.22
485	0.27
486	0.22
487	0.24
488	0.24
489	0.23
490	0.25
491	0.29
492	0.37
493	0.38
494	0.45
495	0.49
496	0.5
497	0.46
498	0.45
499	0.39
500	0.33
501	0.28
502	0.24
503	0.19
504	0.17
505	0.17
506	0.18
507	0.17
508	0.19
509	0.2
510	0.2
511	0.21
512	0.18
513	0.22
514	0.21
515	0.2
516	0.15
517	0.15
518	0.14
519	0.16
520	0.16
521	0.13
522	0.2
523	0.19
524	0.2
525	0.22
526	0.21
527	0.19
528	0.23
529	0.23
530	0.17
531	0.18
532	0.24
533	0.23
534	0.29
535	0.29
536	0.26
537	0.3
538	0.37
539	0.41

T5AKC9

3D AlphaFold-predicted Structure Viewer