Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AQX3

Protein Details
Accession B2AQX3    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MSETRKRKHPANESSIKRTKSSKMTKETPPSKPHydrophilic
194-219TPPEPVPGQKKPPKQQKGKPNAEFKVHydrophilic
NLS Segment(s)
PositionSequence
7-9RKH
205-207PPK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
KEGG pan:PODANSg2913  -  
PROSITE View protein in PROSITE  
PS50280  SET  
Amino Acid Sequences MSETRKRKHPANESSIKRTKSSKMTKETPPSKPPSQPTPSQPTLSTTPSNDDPFPVNWPKSLPYLTTPAYSPQITPSQLSLLRTLDPDLPTIPGSFPLGPAPHVKITPITDPKHPAHGQSGLFATQHLPPDTLILPYLGHYHPGSGPGLQDEDYDYTKSDYDLWLDRDADVAVDAARAGNEARFVNDYRGIPFTPPEPVPGQKKPPKQQKGKPNAEFKVAWDERTGQKVMSVWVLPRGKKGLNTGIERGEEVMVSYGRGFWEGRKQEGEGEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.75
4 0.68
5 0.62
6 0.6
7 0.6
8 0.64
9 0.63
10 0.64
11 0.69
12 0.75
13 0.81
14 0.82
15 0.79
16 0.78
17 0.76
18 0.73
19 0.74
20 0.71
21 0.69
22 0.67
23 0.65
24 0.64
25 0.66
26 0.63
27 0.58
28 0.53
29 0.48
30 0.46
31 0.44
32 0.39
33 0.31
34 0.32
35 0.33
36 0.36
37 0.31
38 0.29
39 0.27
40 0.25
41 0.3
42 0.32
43 0.29
44 0.26
45 0.28
46 0.28
47 0.29
48 0.29
49 0.25
50 0.21
51 0.25
52 0.26
53 0.25
54 0.24
55 0.23
56 0.25
57 0.24
58 0.21
59 0.19
60 0.22
61 0.22
62 0.22
63 0.2
64 0.21
65 0.22
66 0.23
67 0.21
68 0.18
69 0.18
70 0.18
71 0.19
72 0.18
73 0.17
74 0.16
75 0.15
76 0.15
77 0.14
78 0.14
79 0.13
80 0.1
81 0.11
82 0.1
83 0.1
84 0.12
85 0.11
86 0.12
87 0.14
88 0.16
89 0.16
90 0.16
91 0.15
92 0.15
93 0.17
94 0.23
95 0.27
96 0.27
97 0.28
98 0.33
99 0.34
100 0.39
101 0.38
102 0.32
103 0.29
104 0.31
105 0.28
106 0.24
107 0.24
108 0.17
109 0.16
110 0.15
111 0.13
112 0.11
113 0.13
114 0.12
115 0.11
116 0.1
117 0.12
118 0.13
119 0.11
120 0.09
121 0.07
122 0.07
123 0.07
124 0.1
125 0.08
126 0.09
127 0.09
128 0.1
129 0.1
130 0.11
131 0.11
132 0.09
133 0.09
134 0.08
135 0.09
136 0.08
137 0.08
138 0.08
139 0.09
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.1
146 0.1
147 0.08
148 0.09
149 0.12
150 0.14
151 0.15
152 0.15
153 0.15
154 0.15
155 0.14
156 0.12
157 0.09
158 0.07
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.07
168 0.07
169 0.09
170 0.11
171 0.12
172 0.15
173 0.18
174 0.19
175 0.18
176 0.2
177 0.2
178 0.18
179 0.18
180 0.16
181 0.17
182 0.17
183 0.18
184 0.19
185 0.24
186 0.3
187 0.35
188 0.44
189 0.47
190 0.57
191 0.63
192 0.71
193 0.77
194 0.8
195 0.83
196 0.84
197 0.87
198 0.88
199 0.86
200 0.85
201 0.77
202 0.72
203 0.64
204 0.55
205 0.55
206 0.45
207 0.38
208 0.3
209 0.32
210 0.3
211 0.34
212 0.33
213 0.21
214 0.22
215 0.23
216 0.22
217 0.22
218 0.2
219 0.16
220 0.24
221 0.3
222 0.29
223 0.32
224 0.35
225 0.34
226 0.36
227 0.41
228 0.41
229 0.43
230 0.47
231 0.47
232 0.46
233 0.44
234 0.41
235 0.37
236 0.28
237 0.2
238 0.16
239 0.15
240 0.11
241 0.11
242 0.11
243 0.11
244 0.11
245 0.13
246 0.13
247 0.14
248 0.24
249 0.27
250 0.32
251 0.34
252 0.35