Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AQ01

Protein Details
Accession B2AQ01    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
35-57STGIWRRERCRRKGERWMRERGRBasic
NLS Segment(s)
PositionSequence
19-79RRLGMRRPSRRNGWRTSTGIWRRERCRRKGERWMRERGRWMRRGSWPCLKRLDSGGRLKRR
Subcellular Location(s) nucl 15.5, mito_nucl 13.166, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
KEGG pan:PODANSg3302  -  
Amino Acid Sequences MSDANRQRSMRWNAEPLWRRLGMRRPSRRNGWRTSTGIWRRERCRRKGERWMRERGRWMRRGSWPCLKRLDSGGRLKRRLKCSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.56
4 0.54
5 0.48
6 0.44
7 0.45
8 0.5
9 0.5
10 0.54
11 0.61
12 0.63
13 0.68
14 0.77
15 0.8
16 0.77
17 0.75
18 0.71
19 0.67
20 0.62
21 0.58
22 0.58
23 0.55
24 0.55
25 0.55
26 0.54
27 0.54
28 0.61
29 0.66
30 0.63
31 0.67
32 0.69
33 0.71
34 0.76
35 0.8
36 0.8
37 0.78
38 0.82
39 0.78
40 0.74
41 0.76
42 0.74
43 0.72
44 0.69
45 0.67
46 0.63
47 0.67
48 0.68
49 0.65
50 0.66
51 0.6
52 0.58
53 0.61
54 0.56
55 0.49
56 0.5
57 0.52
58 0.5
59 0.57
60 0.62
61 0.64
62 0.69
63 0.74
64 0.76