Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T4ZY79

Protein Details
Accession T4ZY79    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
115-135LSVNQAKKMQKEERKKKRSGDHydrophilic
NLS Segment(s)
PositionSequence
122-134KMQKEERKKKRSG
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR023179  GTP-bd_ortho_bundle_sf  
Amino Acid Sequences MPGRIRLNIAFNSVGIKKGLIPDRILADYLLYRLNWWDPALYARYCPPTNDVDDFLAAVARRDGKLKAGGLPNLHEAAARVLSQWRDGKLGRYVLDDLSDDDVRAHQLLVQEPQLSVNQAKKMQKEERKKKRSGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.17
4 0.15
5 0.21
6 0.27
7 0.25
8 0.26
9 0.27
10 0.3
11 0.3
12 0.29
13 0.22
14 0.17
15 0.15
16 0.15
17 0.14
18 0.1
19 0.1
20 0.11
21 0.12
22 0.12
23 0.12
24 0.11
25 0.1
26 0.13
27 0.16
28 0.15
29 0.15
30 0.16
31 0.22
32 0.22
33 0.22
34 0.22
35 0.21
36 0.24
37 0.25
38 0.24
39 0.19
40 0.18
41 0.17
42 0.14
43 0.13
44 0.09
45 0.07
46 0.07
47 0.07
48 0.07
49 0.09
50 0.09
51 0.1
52 0.13
53 0.13
54 0.17
55 0.18
56 0.19
57 0.19
58 0.2
59 0.19
60 0.17
61 0.16
62 0.12
63 0.1
64 0.09
65 0.1
66 0.08
67 0.07
68 0.09
69 0.09
70 0.14
71 0.16
72 0.15
73 0.18
74 0.18
75 0.21
76 0.24
77 0.26
78 0.23
79 0.23
80 0.23
81 0.21
82 0.21
83 0.18
84 0.15
85 0.16
86 0.16
87 0.13
88 0.12
89 0.12
90 0.12
91 0.12
92 0.11
93 0.08
94 0.11
95 0.13
96 0.16
97 0.17
98 0.17
99 0.17
100 0.19
101 0.18
102 0.18
103 0.19
104 0.21
105 0.24
106 0.31
107 0.36
108 0.39
109 0.46
110 0.54
111 0.61
112 0.68
113 0.73
114 0.78
115 0.82