Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5AK28

Protein Details
Accession Q5AK28    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-90EQFNKIKQLRKRLDRCLKMTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
KEGG cal:CAALFM_C505010WA  -  
Amino Acid Sequences MSGDLHNDLHQIELTAHALLSGSLDNLNENFESLNQSQLILLTRLKIIEERLSNFKSIINDNTINEKELEEQFNKIKQLRKRLDRCLKMTESIEMRVDKLEDQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.08
5 0.08
6 0.07
7 0.08
8 0.06
9 0.05
10 0.06
11 0.06
12 0.07
13 0.07
14 0.09
15 0.08
16 0.08
17 0.07
18 0.07
19 0.12
20 0.12
21 0.13
22 0.12
23 0.12
24 0.12
25 0.12
26 0.13
27 0.1
28 0.1
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.12
36 0.14
37 0.16
38 0.2
39 0.21
40 0.21
41 0.21
42 0.21
43 0.18
44 0.18
45 0.18
46 0.17
47 0.18
48 0.18
49 0.24
50 0.22
51 0.21
52 0.2
53 0.19
54 0.17
55 0.18
56 0.21
57 0.16
58 0.19
59 0.21
60 0.24
61 0.27
62 0.28
63 0.33
64 0.36
65 0.45
66 0.52
67 0.6
68 0.65
69 0.72
70 0.79
71 0.8
72 0.79
73 0.77
74 0.7
75 0.64
76 0.58
77 0.53
78 0.46
79 0.4
80 0.4
81 0.32
82 0.3
83 0.27
84 0.27