Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A5Q0

Protein Details
Accession T5A5Q0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-47MGRPTARRRRKRLTWAKQVNIPKTRNTYCKGKECRKHTQHKVTQYKAHydrophilic
89-109LECVKCKTKCQLALKRCKHFEHydrophilic
NLS Segment(s)
PositionSequence
6-12ARRRRKR
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MGRPTARRRRKRLTWAKQVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKTKCQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.87
4 0.85
5 0.83
6 0.81
7 0.78
8 0.7
9 0.65
10 0.63
11 0.63
12 0.62
13 0.58
14 0.59
15 0.57
16 0.65
17 0.68
18 0.7
19 0.73
20 0.73
21 0.79
22 0.79
23 0.82
24 0.83
25 0.84
26 0.81
27 0.83
28 0.85
29 0.77
30 0.76
31 0.7
32 0.64
33 0.56
34 0.51
35 0.4
36 0.32
37 0.31
38 0.3
39 0.29
40 0.26
41 0.31
42 0.35
43 0.38
44 0.43
45 0.47
46 0.44
47 0.5
48 0.57
49 0.55
50 0.56
51 0.55
52 0.55
53 0.54
54 0.57
55 0.48
56 0.44
57 0.41
58 0.34
59 0.36
60 0.38
61 0.38
62 0.33
63 0.4
64 0.44
65 0.52
66 0.61
67 0.64
68 0.63
69 0.67
70 0.73
71 0.74
72 0.73
73 0.68
74 0.65
75 0.66
76 0.66
77 0.65
78 0.6
79 0.6
80 0.55
81 0.55
82 0.56
83 0.55
84 0.57
85 0.61
86 0.67
87 0.68
88 0.78
89 0.81
90 0.83
91 0.79
92 0.73
93 0.66
94 0.58
95 0.55
96 0.55
97 0.55
98 0.53
99 0.55
100 0.52
101 0.49
102 0.49
103 0.42