Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AR24

Protein Details
Accession T5AR24   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
19-65ALARSRGRRLRSRGRRPRSHRRRPHSHRRRPRSHRRRPRSPGAPAPEBasic
NLS Segment(s)
PositionSequence
21-61ARSRGRRLRSRGRRPRSHRRRPHSHRRRPRSHRRRPRSPGA
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MATASDETAVLGCEAQRPALARSRGRRLRSRGRRPRSHRRRPHSHRRRPRSHRRRPRSPGAPAPEMGGVFRAPSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.13
5 0.15
6 0.22
7 0.28
8 0.31
9 0.37
10 0.47
11 0.53
12 0.57
13 0.63
14 0.63
15 0.69
16 0.74
17 0.79
18 0.79
19 0.82
20 0.86
21 0.87
22 0.9
23 0.9
24 0.9
25 0.89
26 0.87
27 0.89
28 0.88
29 0.9
30 0.9
31 0.9
32 0.9
33 0.91
34 0.92
35 0.91
36 0.94
37 0.93
38 0.94
39 0.94
40 0.93
41 0.94
42 0.91
43 0.91
44 0.89
45 0.86
46 0.84
47 0.8
48 0.73
49 0.63
50 0.56
51 0.47
52 0.39
53 0.3
54 0.22
55 0.15
56 0.11