Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B3B0

Protein Details
Accession B2B3B0   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29STYKSMHHMYKRFRKAKRQVDSDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
KEGG pan:PODANSg7499  -  
Amino Acid Sequences MPHTMSTYKSMHHMYKRFRKAKRQVDSDTSTINIQNRAAIMDMQKENAALKREGEKLRVEGEGLKVRIESLESQVKELNGAMSYVLGVKSEELKGDRRWYQPLEGQWKKWKGME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.63
3 0.72
4 0.76
5 0.78
6 0.82
7 0.83
8 0.86
9 0.85
10 0.82
11 0.78
12 0.77
13 0.74
14 0.65
15 0.56
16 0.46
17 0.38
18 0.32
19 0.28
20 0.21
21 0.17
22 0.15
23 0.14
24 0.13
25 0.13
26 0.12
27 0.11
28 0.14
29 0.14
30 0.14
31 0.14
32 0.14
33 0.14
34 0.16
35 0.18
36 0.12
37 0.14
38 0.17
39 0.23
40 0.24
41 0.25
42 0.23
43 0.22
44 0.23
45 0.22
46 0.18
47 0.13
48 0.16
49 0.18
50 0.17
51 0.16
52 0.14
53 0.14
54 0.14
55 0.14
56 0.11
57 0.11
58 0.17
59 0.17
60 0.19
61 0.2
62 0.2
63 0.19
64 0.18
65 0.15
66 0.08
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.06
76 0.09
77 0.09
78 0.12
79 0.13
80 0.18
81 0.22
82 0.29
83 0.34
84 0.35
85 0.41
86 0.42
87 0.45
88 0.46
89 0.51
90 0.55
91 0.54
92 0.58
93 0.62
94 0.64