Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5ACM0

Protein Details
Accession T5ACM0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-112ANSERRVRDRRVRSVRCVRDRRHBasic
NLS Segment(s)
Subcellular Location(s) extr 18, E.R. 4, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001064  Beta/gamma_crystallin  
IPR011024  G_crystallin-like  
Amino Acid Sequences MLFTNIFALAFATLVAAETAEVQHEARDNYAATLYSQPNFHGASRRVDRGRCYDLGRPLRGDVQSIRVDRGDDCFLYEGERCNGRRTRYANSERRVRDRRVRSVRCVRDRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.06
9 0.06
10 0.07
11 0.1
12 0.1
13 0.1
14 0.12
15 0.11
16 0.11
17 0.12
18 0.11
19 0.1
20 0.15
21 0.15
22 0.15
23 0.15
24 0.15
25 0.17
26 0.18
27 0.18
28 0.2
29 0.2
30 0.27
31 0.3
32 0.35
33 0.36
34 0.37
35 0.39
36 0.38
37 0.4
38 0.34
39 0.34
40 0.33
41 0.38
42 0.41
43 0.39
44 0.34
45 0.3
46 0.31
47 0.28
48 0.26
49 0.18
50 0.18
51 0.22
52 0.22
53 0.22
54 0.19
55 0.2
56 0.18
57 0.21
58 0.18
59 0.13
60 0.13
61 0.13
62 0.13
63 0.14
64 0.15
65 0.14
66 0.14
67 0.2
68 0.2
69 0.26
70 0.31
71 0.33
72 0.39
73 0.41
74 0.47
75 0.52
76 0.61
77 0.64
78 0.66
79 0.72
80 0.71
81 0.77
82 0.75
83 0.73
84 0.73
85 0.73
86 0.77
87 0.79
88 0.8
89 0.8
90 0.84
91 0.86
92 0.87