Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T5AHU1

Protein Details
Accession T5AHU1    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-59PDGPWRRKVTKIKKDLIHKAKVBasic
NLS Segment(s)
PositionSequence
25-69KLKRGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKAYAKIKAR
176-210QRHEERERKLAERGRFKKAMAKTRGRDGKKKLGRE
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MGLKRKLDGSEPEPEPESAQASNKKLKRGFRVGPDNLPDGPWRRKVTKIKKDLIHKAKVKKAYAKIKAREQPASAGAASSTVATPGHDQSPRNDDAELNGSVAENAMAEQPMHPTRELMLKDEENAQAGATPAETDAMASDGNRRRSRRPGYYDKQLEKAEERRQQADQRAEELRQRHEERERKLAERGRFKKAMAKTRGRDGKKKLGRESNLLLDKVKKLVAEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.3
4 0.28
5 0.21
6 0.25
7 0.29
8 0.32
9 0.41
10 0.42
11 0.49
12 0.52
13 0.58
14 0.61
15 0.64
16 0.66
17 0.66
18 0.73
19 0.69
20 0.7
21 0.66
22 0.6
23 0.5
24 0.45
25 0.39
26 0.35
27 0.37
28 0.38
29 0.4
30 0.4
31 0.49
32 0.58
33 0.65
34 0.69
35 0.73
36 0.74
37 0.75
38 0.81
39 0.83
40 0.81
41 0.79
42 0.76
43 0.75
44 0.73
45 0.73
46 0.69
47 0.67
48 0.67
49 0.68
50 0.7
51 0.71
52 0.7
53 0.73
54 0.74
55 0.7
56 0.65
57 0.56
58 0.49
59 0.41
60 0.37
61 0.27
62 0.21
63 0.16
64 0.12
65 0.11
66 0.08
67 0.07
68 0.05
69 0.05
70 0.06
71 0.07
72 0.09
73 0.12
74 0.15
75 0.15
76 0.18
77 0.23
78 0.24
79 0.23
80 0.22
81 0.18
82 0.18
83 0.2
84 0.18
85 0.12
86 0.11
87 0.1
88 0.09
89 0.09
90 0.07
91 0.03
92 0.03
93 0.03
94 0.04
95 0.04
96 0.04
97 0.07
98 0.09
99 0.1
100 0.1
101 0.09
102 0.1
103 0.16
104 0.16
105 0.15
106 0.17
107 0.16
108 0.17
109 0.2
110 0.19
111 0.14
112 0.14
113 0.11
114 0.08
115 0.08
116 0.08
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.03
124 0.04
125 0.04
126 0.04
127 0.12
128 0.17
129 0.25
130 0.31
131 0.34
132 0.38
133 0.47
134 0.56
135 0.58
136 0.61
137 0.64
138 0.66
139 0.73
140 0.77
141 0.71
142 0.69
143 0.61
144 0.55
145 0.5
146 0.5
147 0.49
148 0.46
149 0.47
150 0.44
151 0.47
152 0.51
153 0.53
154 0.54
155 0.46
156 0.44
157 0.44
158 0.42
159 0.43
160 0.4
161 0.38
162 0.39
163 0.4
164 0.42
165 0.49
166 0.55
167 0.55
168 0.61
169 0.6
170 0.55
171 0.6
172 0.61
173 0.6
174 0.63
175 0.64
176 0.62
177 0.6
178 0.58
179 0.58
180 0.59
181 0.61
182 0.59
183 0.64
184 0.6
185 0.68
186 0.76
187 0.75
188 0.76
189 0.74
190 0.75
191 0.74
192 0.78
193 0.77
194 0.77
195 0.75
196 0.74
197 0.71
198 0.7
199 0.67
200 0.59
201 0.53
202 0.47
203 0.44
204 0.4
205 0.36
206 0.26