Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A6H2

Protein Details
Accession T5A6H2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-71RMLSERRREKRSKRLRQMISGPKBasic
NLS Segment(s)
PositionSequence
46-64KLPRMLSERRREKRSKRLR
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MRGAAYAAPDANERRGFWGGRGLRQRGGQEVMRRSAMGRPWEGIQKLPRMLSERRREKRSKRLRQMISGPKDVRDGVREVIEPRGPQALRQTDGYGLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.27
4 0.25
5 0.32
6 0.3
7 0.35
8 0.42
9 0.41
10 0.41
11 0.43
12 0.44
13 0.38
14 0.39
15 0.35
16 0.35
17 0.36
18 0.35
19 0.32
20 0.31
21 0.28
22 0.28
23 0.28
24 0.24
25 0.21
26 0.2
27 0.21
28 0.25
29 0.24
30 0.24
31 0.23
32 0.23
33 0.23
34 0.22
35 0.22
36 0.22
37 0.27
38 0.32
39 0.39
40 0.47
41 0.52
42 0.59
43 0.66
44 0.7
45 0.76
46 0.79
47 0.8
48 0.8
49 0.83
50 0.8
51 0.79
52 0.81
53 0.8
54 0.74
55 0.71
56 0.61
57 0.52
58 0.5
59 0.44
60 0.36
61 0.28
62 0.25
63 0.19
64 0.21
65 0.21
66 0.2
67 0.25
68 0.26
69 0.23
70 0.22
71 0.28
72 0.25
73 0.26
74 0.34
75 0.35
76 0.34
77 0.37
78 0.37