Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5AHH6

Protein Details
Accession T5AHH6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-26IVSRSGRNKKGRGHTKPIRCSNCSHydrophilic
80-110GKIVRVRSRVGRRNRAPPPRVRYNKDGKKIVBasic
NLS Segment(s)
PositionSequence
84-108RVRSRVGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MLIVSRSGRNKKGRGHTKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSRVGRRNRAPPPRVRYNKDGKKIVPTTPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.81
4 0.83
5 0.86
6 0.87
7 0.84
8 0.77
9 0.78
10 0.76
11 0.76
12 0.74
13 0.71
14 0.68
15 0.69
16 0.71
17 0.7
18 0.71
19 0.71
20 0.72
21 0.73
22 0.75
23 0.71
24 0.72
25 0.67
26 0.67
27 0.6
28 0.52
29 0.45
30 0.37
31 0.34
32 0.27
33 0.24
34 0.15
35 0.14
36 0.11
37 0.1
38 0.09
39 0.08
40 0.07
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.05
48 0.06
49 0.07
50 0.07
51 0.07
52 0.08
53 0.11
54 0.17
55 0.19
56 0.21
57 0.23
58 0.24
59 0.25
60 0.27
61 0.25
62 0.2
63 0.2
64 0.19
65 0.2
66 0.2
67 0.22
68 0.23
69 0.29
70 0.31
71 0.32
72 0.34
73 0.38
74 0.47
75 0.53
76 0.6
77 0.64
78 0.66
79 0.74
80 0.81
81 0.82
82 0.79
83 0.8
84 0.79
85 0.79
86 0.82
87 0.79
88 0.78
89 0.78
90 0.81
91 0.8
92 0.79
93 0.71
94 0.72
95 0.69
96 0.69