Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A983

Protein Details
Accession T5A983    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
300-333DLRHHPIKIKPKFPKEWRLTDKRRRQLEKIRGGIBasic
NLS Segment(s)
PositionSequence
306-328IKIKPKFPKEWRLTDKRRRQLEK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MASASNAARLCLSACRRAPRLHAPCRAPPRPGPQAVAPRLLTTSSVRWADEERRKRINNDADDETYQNLELKMMNKSFAESVTTEGLQQLDELAKTRGHSSIDAYLESFFRGNHQLASEDRALFEELSDVDIGEKPDTKSFWFDEEDPETNTNEHDEFKEDDITSMAHGKLDEVREMRHYARLAAWEMPLLSKLAKPFVPPTNDQVLRWRYTTYMGESHPAEKKVVVQFAPDDLKLTTVQTNKLRKLAGPRYNPETEFVKMSCESFEHQAQNKRYLSKLVDDLIAAAKDPTDTFEDLPLDLRHHPIKIKPKFPKEWRLTDKRRRQLEKIRGGIAAMEATKAEQGRLVSGQQMIEEFLLVKSVEEQEMQAKLQAAQAVTMPKSTRMSSMASRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.48
4 0.52
5 0.58
6 0.6
7 0.66
8 0.67
9 0.7
10 0.69
11 0.74
12 0.79
13 0.77
14 0.72
15 0.69
16 0.69
17 0.69
18 0.67
19 0.61
20 0.59
21 0.64
22 0.62
23 0.61
24 0.52
25 0.44
26 0.41
27 0.37
28 0.31
29 0.25
30 0.24
31 0.24
32 0.25
33 0.24
34 0.25
35 0.29
36 0.37
37 0.44
38 0.5
39 0.51
40 0.59
41 0.62
42 0.63
43 0.68
44 0.68
45 0.65
46 0.62
47 0.6
48 0.55
49 0.54
50 0.52
51 0.43
52 0.34
53 0.26
54 0.22
55 0.16
56 0.13
57 0.13
58 0.14
59 0.19
60 0.19
61 0.21
62 0.19
63 0.21
64 0.21
65 0.19
66 0.2
67 0.14
68 0.16
69 0.17
70 0.17
71 0.15
72 0.15
73 0.15
74 0.12
75 0.11
76 0.09
77 0.08
78 0.08
79 0.1
80 0.1
81 0.11
82 0.12
83 0.14
84 0.15
85 0.16
86 0.16
87 0.18
88 0.22
89 0.22
90 0.21
91 0.2
92 0.19
93 0.17
94 0.17
95 0.15
96 0.09
97 0.1
98 0.14
99 0.14
100 0.14
101 0.15
102 0.16
103 0.17
104 0.21
105 0.21
106 0.18
107 0.17
108 0.17
109 0.17
110 0.15
111 0.14
112 0.1
113 0.08
114 0.09
115 0.08
116 0.07
117 0.07
118 0.08
119 0.09
120 0.09
121 0.12
122 0.12
123 0.14
124 0.15
125 0.15
126 0.17
127 0.17
128 0.19
129 0.2
130 0.19
131 0.22
132 0.25
133 0.26
134 0.25
135 0.25
136 0.22
137 0.2
138 0.19
139 0.16
140 0.13
141 0.12
142 0.11
143 0.12
144 0.13
145 0.15
146 0.17
147 0.15
148 0.15
149 0.14
150 0.14
151 0.11
152 0.12
153 0.11
154 0.08
155 0.08
156 0.08
157 0.11
158 0.12
159 0.14
160 0.12
161 0.13
162 0.15
163 0.18
164 0.18
165 0.19
166 0.18
167 0.16
168 0.17
169 0.18
170 0.17
171 0.16
172 0.15
173 0.12
174 0.11
175 0.1
176 0.1
177 0.08
178 0.07
179 0.07
180 0.07
181 0.09
182 0.1
183 0.11
184 0.15
185 0.19
186 0.22
187 0.23
188 0.27
189 0.33
190 0.33
191 0.32
192 0.35
193 0.34
194 0.32
195 0.31
196 0.27
197 0.2
198 0.22
199 0.23
200 0.18
201 0.18
202 0.17
203 0.19
204 0.19
205 0.22
206 0.23
207 0.22
208 0.2
209 0.17
210 0.21
211 0.21
212 0.23
213 0.19
214 0.17
215 0.16
216 0.19
217 0.21
218 0.16
219 0.14
220 0.11
221 0.13
222 0.12
223 0.13
224 0.14
225 0.14
226 0.2
227 0.26
228 0.33
229 0.34
230 0.37
231 0.36
232 0.34
233 0.42
234 0.46
235 0.48
236 0.48
237 0.5
238 0.53
239 0.55
240 0.54
241 0.47
242 0.4
243 0.32
244 0.28
245 0.24
246 0.21
247 0.18
248 0.18
249 0.16
250 0.14
251 0.15
252 0.16
253 0.21
254 0.23
255 0.28
256 0.36
257 0.39
258 0.45
259 0.46
260 0.45
261 0.41
262 0.4
263 0.37
264 0.32
265 0.32
266 0.26
267 0.24
268 0.22
269 0.21
270 0.19
271 0.16
272 0.12
273 0.09
274 0.08
275 0.07
276 0.08
277 0.09
278 0.1
279 0.12
280 0.12
281 0.15
282 0.16
283 0.16
284 0.19
285 0.17
286 0.17
287 0.17
288 0.2
289 0.2
290 0.21
291 0.24
292 0.29
293 0.39
294 0.44
295 0.53
296 0.59
297 0.66
298 0.74
299 0.79
300 0.83
301 0.8
302 0.82
303 0.82
304 0.83
305 0.85
306 0.85
307 0.87
308 0.86
309 0.88
310 0.85
311 0.84
312 0.84
313 0.84
314 0.83
315 0.78
316 0.71
317 0.61
318 0.54
319 0.46
320 0.36
321 0.27
322 0.17
323 0.12
324 0.09
325 0.09
326 0.12
327 0.12
328 0.11
329 0.11
330 0.11
331 0.14
332 0.16
333 0.17
334 0.17
335 0.18
336 0.18
337 0.16
338 0.17
339 0.15
340 0.13
341 0.12
342 0.1
343 0.08
344 0.09
345 0.09
346 0.09
347 0.1
348 0.12
349 0.13
350 0.13
351 0.14
352 0.17
353 0.19
354 0.19
355 0.19
356 0.19
357 0.18
358 0.21
359 0.22
360 0.18
361 0.17
362 0.19
363 0.22
364 0.21
365 0.24
366 0.23
367 0.24
368 0.28
369 0.28
370 0.29
371 0.26
372 0.31
373 0.32
374 0.41