Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T5A596

Protein Details
Accession T5A596   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
246-275FPSARLEQGRCRRRHRARLRRGLREGEGRRBasic
NLS Segment(s)
PositionSequence
257-276RRRHRARLRRGLREGEGRRP
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
Amino Acid Sequences MLLRRRSSIPNLPREHFASLRSRLRPPIVGRFALGILDAGLQAHLESVAGSLVGLARSLRLAIELEGAFALPKALPVLGRAHGDYRHEAVVAGLAAPELVLEGEPRVLARVEFLPERRLLLGIPLRGPACVEFVLQPRLAASAVVQAGLALVQRCRVPVAGAGVSSSLPGDDDDKRRSSDPNGLVSDAVQAALPSAVEPLTSGAPHVRLTMLDARLRACRGEKRCNNIKTAGVYCTGTGLGFRHAFPSARLEQGRCRRRHRARLRRGLREGEGRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.5
4 0.45
5 0.43
6 0.45
7 0.5
8 0.5
9 0.51
10 0.51
11 0.54
12 0.56
13 0.54
14 0.56
15 0.54
16 0.5
17 0.46
18 0.42
19 0.38
20 0.31
21 0.25
22 0.14
23 0.09
24 0.08
25 0.07
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.11
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.07
64 0.1
65 0.12
66 0.14
67 0.14
68 0.16
69 0.18
70 0.2
71 0.21
72 0.2
73 0.18
74 0.17
75 0.16
76 0.13
77 0.13
78 0.1
79 0.08
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.02
86 0.02
87 0.02
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.09
99 0.12
100 0.13
101 0.14
102 0.14
103 0.16
104 0.14
105 0.13
106 0.11
107 0.14
108 0.16
109 0.15
110 0.15
111 0.16
112 0.15
113 0.15
114 0.15
115 0.11
116 0.1
117 0.09
118 0.09
119 0.09
120 0.11
121 0.13
122 0.13
123 0.13
124 0.11
125 0.11
126 0.1
127 0.08
128 0.06
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.07
137 0.04
138 0.04
139 0.05
140 0.06
141 0.06
142 0.07
143 0.07
144 0.07
145 0.08
146 0.11
147 0.11
148 0.1
149 0.1
150 0.1
151 0.1
152 0.09
153 0.08
154 0.04
155 0.04
156 0.04
157 0.07
158 0.11
159 0.15
160 0.19
161 0.21
162 0.23
163 0.24
164 0.26
165 0.27
166 0.31
167 0.31
168 0.33
169 0.33
170 0.32
171 0.3
172 0.28
173 0.26
174 0.17
175 0.14
176 0.07
177 0.06
178 0.05
179 0.05
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.06
188 0.06
189 0.07
190 0.08
191 0.1
192 0.1
193 0.11
194 0.1
195 0.09
196 0.13
197 0.19
198 0.21
199 0.21
200 0.22
201 0.23
202 0.26
203 0.27
204 0.25
205 0.24
206 0.3
207 0.35
208 0.45
209 0.5
210 0.56
211 0.65
212 0.66
213 0.66
214 0.61
215 0.57
216 0.52
217 0.48
218 0.41
219 0.34
220 0.31
221 0.26
222 0.23
223 0.2
224 0.14
225 0.12
226 0.11
227 0.14
228 0.15
229 0.15
230 0.16
231 0.18
232 0.19
233 0.19
234 0.26
235 0.23
236 0.29
237 0.32
238 0.33
239 0.41
240 0.51
241 0.59
242 0.6
243 0.65
244 0.69
245 0.77
246 0.85
247 0.87
248 0.87
249 0.89
250 0.92
251 0.94
252 0.93
253 0.9
254 0.86
255 0.81
256 0.81